Q5RKH0 · GLYR1_RAT
- ProteinCytokine-like nuclear factor N-PAC
- GeneGlyr1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids552 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cytokine-like nuclear factor with chromatin gene reader activity involved in chromatin modification and regulation of gene expression. Acts as a nucleosome-destabilizing factor that is recruited to genes during transcriptional activation. Recognizes and binds histone H3 without a preference for specific epigenetic markers and also binds DNA. Interacts with KDM1B and promotes its histone demethylase activity by facilitating the capture of H3 tails, they form a multifunctional enzyme complex that modifies transcribed chromatin and facilitates Pol II transcription through nucleosomes. Stimulates the acetylation of 'Lys-56' of nucleosomal histone H3 (H3K56ac) by EP300. With GATA4, co-binds a defined set of heart development genes and coregulates their expression during cardiomyocyte differentiation. Regulates p38 MAP kinase activity by mediating stress activation of MAPK14/p38alpha and specifically regulating MAPK14 signaling. Indirectly promotes phosphorylation of MAPK14 and activation of ATF2. The phosphorylation of MAPK14 requires upstream activity of MAP2K4 and MAP2K6.
Features
Showing features for dna binding, site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 167-179 | A.T hook | ||||
Sequence: PRKRGRPPKDEKD | ||||||
Site | 216 | Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2 | ||||
Sequence: F | ||||||
Binding site | 270-284 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: GFLGLGLMGSGIVSN | ||||||
Binding site | 361 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 504 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: K |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | nucleosome | |
Cellular Component | nucleus | |
Molecular Function | chromatin binding | |
Molecular Function | chromatin-protein adaptor activity | |
Molecular Function | DNA binding | |
Molecular Function | histone binding | |
Molecular Function | methylated histone binding | |
Molecular Function | NAD binding | |
Molecular Function | NADP binding | |
Molecular Function | nucleosome binding | |
Biological Process | transcription elongation-coupled chromatin remodeling | |
Biological Process | transcription initiation-coupled chromatin remodeling |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameCytokine-like nuclear factor N-PAC
- Short namesNPAC
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ5RKH0
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Found in actively RNAPolII-transcribed gene bodies.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000312123 | 1-552 | Cytokine-like nuclear factor N-PAC | |||
Sequence: MAAVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHTSADDKNRRNSSEERSRPNSGDEKRKLSLSEGKVKKNMGEGKKRVTSGSADRGSKCLKRAQEQSPRKRGRPPKDEKDLTIPESSTVKGMMAGPMAAFKWQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH | ||||||
Modified residue | 130 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 135 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 166 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 175 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 178 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 200 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 210 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 226 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 236 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 239 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 268 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 301 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 539 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Homotetramere. Interacts with MAPK14. Interacts with KDM1B at nucleosomes; this interaction stimulates H3K4me1 and H3K4me2 demethylation. Binds to mononucleosomes. Interacts with GATA4; the interaction is required for a synergistic activation of GATA4 target genes transcription.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 8-66 | PWWP | ||||
Sequence: LGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAH | ||||||
Compositional bias | 91-183 | Basic and acidic residues | ||||
Sequence: RRAKGKDQTSSHTSADDKNRRNSSEERSRPNSGDEKRKLSLSEGKVKKNMGEGKKRVTSGSADRGSKCLKRAQEQSPRKRGRPPKDEKDLTIP | ||||||
Region | 91-187 | Disordered | ||||
Sequence: RRAKGKDQTSSHTSADDKNRRNSSEERSRPNSGDEKRKLSLSEGKVKKNMGEGKKRVTSGSADRGSKCLKRAQEQSPRKRGRPPKDEKDLTIPESST | ||||||
Region | 213-216 | Interaction with histone H3 | ||||
Sequence: DPHF | ||||||
Region | 215-224 | Interaction with KDM1B | ||||
Sequence: HFHHFLLSQT | ||||||
Region | 260-552 | Dehydrogenase domain | ||||
Sequence: GSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH |
Domain
The PWWP domain probably mediates the binding to H3K36me3.
The A.T hook DNA-binding domain is required for the interaction with MAPK14.
The PWWP domain is a H3 reader and strongly binds DNA.
In the dehydrogenase domain, the conserved NAD(P)H-binding sites and sequence similarity to plant dehydrogenases suggest that this protein may have oxidoreductase activity. However, since the active site is not conserved, the dehydrogenase domain seems to serve as a catalytically inert oligomerization module.
Sequence similarities
Belongs to the HIBADH-related family. NP60 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length552
- Mass (Da)60,421
- Last updated2004-12-21 v1
- Checksum5970FC59C54895FA
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8L2Q224 | A0A8L2Q224_RAT | Glyr1 | 549 | ||
A0A8I6GIU5 | A0A8I6GIU5_RAT | Glyr1 | 471 | ||
A0A8I6AEB1 | A0A8I6AEB1_RAT | Glyr1 | 442 | ||
A0A8I5ZPH2 | A0A8I5ZPH2_RAT | Glyr1 | 551 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 91-183 | Basic and acidic residues | ||||
Sequence: RRAKGKDQTSSHTSADDKNRRNSSEERSRPNSGDEKRKLSLSEGKVKKNMGEGKKRVTSGSADRGSKCLKRAQEQSPRKRGRPPKDEKDLTIP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC085931 EMBL· GenBank· DDBJ | AAH85931.1 EMBL· GenBank· DDBJ | mRNA |