Q5PPG4 · ZN639_RAT
- ProteinZinc finger protein 639
- GeneZnf639
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids485 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Binds DNA and may function as a transcriptional repressor.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | negative regulation by host of viral transcription | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | positive regulation by host of viral transcription | |
Biological Process | positive regulation of cell growth | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | symbiont entry into host cell |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameZinc finger protein 639
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ5PPG4
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000383574 | 1-485 | Zinc finger protein 639 | |||
Sequence: MSEYPKKRKRKTLHPSRYSDSSGISRIADGVSGIFSDHCYSVCSMRQPDLKYFDNKDDDSDPETANDLPKFTDGTKARSRSQSCLVPSPVLRILEHTVFSTEKPADVEICDEECGSPESGHQHTHEESPIEVHTSEDVPIAVEVHAISEDYDIEAENNSSESLLDQTDEEPPAKLCKILDKSQASNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHVILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSSSSELYLHFQEHSRDEQYLCQFCEHETGDPEDLHSHVVNEHARRLIELSDKCGSGGHGQCSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLPVHETT | ||||||
Modified residue | 60 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 76 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 88 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 177 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 181 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 226 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for region, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-23 | Disordered | ||||
Sequence: MSEYPKKRKRKTLHPSRYSDSSG | ||||||
Region | 54-82 | Disordered | ||||
Sequence: DNKDDDSDPETANDLPKFTDGTKARSRSQ | ||||||
Zinc finger | 204-227 | C2H2-type 1 | ||||
Sequence: YKCELCEFNSKYFSDLKQHVILKH | ||||||
Zinc finger | 233-255 | C2H2-type 2 | ||||
Sequence: NVCRVCKESFSTNMLLIEHAKLH | ||||||
Zinc finger | 260-283 | C2H2-type 3 | ||||
Sequence: YICKYCDYKTVIFENLSQHIADTH | ||||||
Zinc finger | 289-311 | C2H2-type 4 | ||||
Sequence: YWCEQCDVQFSSSSELYLHFQEH | ||||||
Region | 371-455 | Interaction with CTNNA2 | ||||
Sequence: KNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHS | ||||||
Zinc finger | 374-397 | C2H2-type 5 | ||||
Sequence: FVCQVCGFRSRLHTNVNRHVAIEH | ||||||
Zinc finger | 403-425 | C2H2-type 6 | ||||
Sequence: HVCDDCGKGFSSMLEYCKHLNSH | ||||||
Zinc finger | 431-454 | C2H2-type 7 | ||||
Sequence: YLCQYCEYSTGQIEDLKIHLDFKH | ||||||
Zinc finger | 460-482 | C2H2-type 8 | ||||
Sequence: HKCSDCLMRFGNERELISHLPVH |
Sequence similarities
Belongs to the krueppel C2H2-type zinc-finger protein family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length485
- Mass (Da)55,532
- Last updated2005-01-04 v1
- Checksum08836179B00514D9
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I6AE94 | A0A8I6AE94_RAT | Zfp639 | 509 | ||
A0A8I6A1H8 | A0A8I6A1H8_RAT | Zfp639 | 472 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC087704 EMBL· GenBank· DDBJ | AAH87704.1 EMBL· GenBank· DDBJ | mRNA |