Q5N8R3 · Q5N8R3_ORYSJ
- Proteinphosphoribosylformylglycinamidine synthase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1419 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Pathway
Purine metabolism; IMP biosynthesis via de novo pathway; 5-amino-1-(5-phospho-D-ribosyl)imidazole from N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide: step 1/2.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 1245 | Nucleophile | ||||
Sequence: C | ||||||
Active site | 1380 | |||||
Sequence: H | ||||||
Active site | 1382 | |||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | ATP binding | |
Molecular Function | metal ion binding | |
Molecular Function | phosphoribosylformylglycinamidine synthase activity | |
Biological Process | 'de novo' IMP biosynthetic process | |
Biological Process | glutamine metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namephosphoribosylformylglycinamidine synthase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ5N8R3
- Secondary accessions
Proteomes
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 130-251 | Phosphoribosylformylglycinamidine synthase N-terminal | ||||
Sequence: QCFNIQLDNALTPEKLATLQWLLAETYEPDKLQAQSFLEEEISRSPYSVIVEVGPRMTFSTAFSTNAVSICKSLSLMEVTRLERSRRYLLCLDPGNGPLDESQLNDFAALVHDRMTECVYPN | ||||||
Domain | 278-327 | Phosphoribosylformylglycinamidine synthase linker | ||||
Sequence: LEEINVKMGLAFDEQDIKYYTHLFRDDIKRNPTTVELFDIAQSNSEHSRH | ||||||
Domain | 541-696 | PurM-like C-terminal | ||||
Sequence: IGMLVVKIGGPAYRIGMGGGAASSMVSGQNDAELDFNAVQRGDAEMAQKLYRVVRACAEMGESNPIISIHDQGAGGNCNVVKEIIYPKGAEIDIRSIVVGDHTLSVLEIWGAEYQEQDALLVKPESRSLLESLCERERVSMAVIGTIDGCGKIVLI | ||||||
Domain | 767-920 | FGAR-AT PurM-N-like | ||||
Sequence: SKRFLTTKVDRCVTGLVAQQQTVGPLQLPLADVAVIAQTYTDLTGGACAIGEQPAKGLLNPKAMARLAVGEALTNLVWAKVSSLSDVKASGNWMYAAKLDGEGADMYDAAVALADCMIQLGIAIDGGKDSLSMAAQCDGEVVKAPGNLVISAYV | ||||||
Domain | 951-1081 | PurM-like C-terminal | ||||
Sequence: RRLGGSALAQAFDQIGNDCPDIDDVPYLKKAFEAVQELLSQRLISAGHDISDGGLIVSVLEMAFAGNCGVKLNIDSEDSGLLQALFAEELGLLLEVHLKDLSVVKQKLEAGGISANVIGQVTASPDIELVV |
Sequence similarities
In the N-terminal section; belongs to the FGAMS family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,419
- Mass (Da)154,388
- Last updated2022-01-19 v1
- Checksum3CE50C420652DF78
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP003346 EMBL· GenBank· DDBJ | BAD82143.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP003431 EMBL· GenBank· DDBJ | BAD82369.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000138 EMBL· GenBank· DDBJ | EAZ14425.1 EMBL· GenBank· DDBJ | Genomic DNA |