Q5N6V8 · ORR26_ORYSJ
- ProteinTwo-component response regulator ORR26
- GeneRR26
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids582 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 189-248 | Myb-like GARP | ||||
Sequence: TVKKARVVWSVDLHQKFVNAVNQIGFDKVGPKKILDLMNVPGLTRENVASHLQKYRLYLS |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Biological Process | cytokinin-activated signaling pathway | |
Biological Process | phosphorelay signal transduction system |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTwo-component response regulator ORR26
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ5N6V8
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Dwarf, narrow leaf, low tillering, late heading and low fertility phenotypes.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000433849 | 1-582 | Two-component response regulator ORR26 | |||
Sequence: MDATAFPYGLRVLVVDDDPTWLKILEKMLRKCSYEVTTCGLARVALDILRERKNKFDIVISDVNMPDMDGFKLLEHIGLEMDLPVIMMSIDGETSRVMKGVQHGACDYLLKPVRMKELRNIWQHVYRKKMHEVKEIEGNDSCDDLQILRNSFEGLDEKSLFMRSDSDTMRKRKDVDKDHADQESSDGNTVKKARVVWSVDLHQKFVNAVNQIGFDKVGPKKILDLMNVPGLTRENVASHLQKYRLYLSRLQKQNEERILGAARQDFSHKGTSENLNLRSSFQEQPSNIANGYPHASQNIQTQANMLDSQLEDTKSTVPLPVPDKKRTLASDAADSQNVTSASSLGGVLSFKSMPVNQDRKPSETMILECQAWTGGIPSKQFMQYPKHNHERCDLLGDYSCLPKPDLEHPVGPSNLYAPPPLISMSCGMEGDARDFSDVKPAIMDCIKSLSPALTCTVDSVSVQLSDSVVTSIDGDLKSSGVDGLPSIKDCCLDQTNSQGSLRPSQEPSIIGSTELASLPEDLPSYPLHGVSLENIGLSSIDLLNYSDAMILSGLQSNWYDDLEFSSEMMDYPSIDECLFASS | ||||||
Modified residue | 62 | 4-aspartylphosphate | ||||
Sequence: D |
Post-translational modification
Two-component system major event consists of a His-to-Asp phosphorelay between a sensor histidine kinase (HK) and a response regulator (RR). In plants, the His-to-Asp phosphorelay involves an additional intermediate named Histidine-containing phosphotransfer protein (HPt). This multistep phosphorelay consists of a His-Asp-His-Asp sequential transfer of a phosphate group between first a His and an Asp of the HK protein, followed by the transfer to a conserved His of the HPt protein and finally the transfer to an Asp in the receiver domain of the RR protein.
Keywords
- PTM
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 11-126 | Response regulatory | ||||
Sequence: RVLVVDDDPTWLKILEKMLRKCSYEVTTCGLARVALDILRERKNKFDIVISDVNMPDMDGFKLLEHIGLEMDLPVIMMSIDGETSRVMKGVQHGACDYLLKPVRMKELRNIWQHVY | ||||||
Region | 166-187 | Disordered | ||||
Sequence: SDTMRKRKDVDKDHADQESSDG |
Sequence similarities
Belongs to the ARR family. Type-B subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length582
- Mass (Da)64,813
- Last updated2015-09-16 v2
- ChecksumBFAA2E7386D05E21
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BR000255 EMBL· GenBank· DDBJ | FAA00259.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP006838 EMBL· GenBank· DDBJ | BAD82798.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP008207 EMBL· GenBank· DDBJ | BAF07039.2 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP014957 EMBL· GenBank· DDBJ | BAS75781.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000138 EMBL· GenBank· DDBJ | EEE55842.1 EMBL· GenBank· DDBJ | Genomic DNA |