Q5M9F0 · CSTP1_RAT
- ProteinCentriolar satellite-associated tubulin polyglutamylase complex regulator 1
- GeneCstpp1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids331 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
Regulator of the tubulin polyglutamylase complex (TPGC) that controls cytoskeletal organization, nuclear shape, and cilium disassembly by balancing microtubule and actin assembly. Regulates the assembly and stability of the TPGC and thereby modulates polyglutamylation of the microtubule, which antagonizes MAP4 binding.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | centriolar satellite | |
Cellular Component | cytoplasm | |
Cellular Component | microtubule | |
Molecular Function | protein-macromolecule adaptor activity | |
Biological Process | regulation of protein complex stability |
Names & Taxonomy
Protein names
- Recommended nameCentriolar satellite-associated tubulin polyglutamylase complex regulator 1
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ5M9F0
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associated with microtubules.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000281429 | 1-331 | Centriolar satellite-associated tubulin polyglutamylase complex regulator 1 | |||
Sequence: MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENKEDISQYGIARFFTEYFNSVCQGTHILFREFSFIQATPHNRASFLRAFWRCFRTVGKNGDLLTMREYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLESVAAIYQDLLSGKNPNTVIVPTSSSGQHRQRPALGDAGMLDGVEASLFCQRLENLCDRHKYSCPPPALVKEILSNVQRLTFYGFLVALSKHHGINQALGALPDKGDLMHDPAMDEELERLLVQVPGLVNSITATSEASCLPSRTPPRVGSPWKPLHRSRKLDAESDGSTEETDESET | ||||||
Modified residue | 319 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with PCM1. Interacts with TTLL1, TPGS1, TPGS2 and LRRC49; the interactions link CSTPP1 to the complex TPGC. Binds to alpha-tubulin.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-111 | Required for interaction with PCM1 | ||||
Sequence: MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENKEDISQYGIARFFTEYFNSVCQGTHILFREFSFIQATPHNRASFLRAFWRCFRTVGKNGDLLTMREYHCLLQLLCPD | ||||||
Region | 1-225 | Required for interaction with TPGS1, LRRC49, and TTLL1 | ||||
Sequence: MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENKEDISQYGIARFFTEYFNSVCQGTHILFREFSFIQATPHNRASFLRAFWRCFRTVGKNGDLLTMREYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLESVAAIYQDLLSGKNPNTVIVPTSSSGQHRQRPALGDAGMLDGVEASLFCQRLENLCDRHKYSCPPPALVKE | ||||||
Region | 112-331 | Required for interaction with TPGS2 | ||||
Sequence: FPLELTQKAARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLESVAAIYQDLLSGKNPNTVIVPTSSSGQHRQRPALGDAGMLDGVEASLFCQRLENLCDRHKYSCPPPALVKEILSNVQRLTFYGFLVALSKHHGINQALGALPDKGDLMHDPAMDEELERLLVQVPGLVNSITATSEASCLPSRTPPRVGSPWKPLHRSRKLDAESDGSTEETDESET | ||||||
Region | 292-331 | Disordered | ||||
Sequence: SCLPSRTPPRVGSPWKPLHRSRKLDAESDGSTEETDESET |
Sequence similarities
Belongs to the CSTPP1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length331
- Mass (Da)37,476
- Last updated2005-02-01 v1
- Checksum64CCA6B1EA9A8B37
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I6AK47 | A0A8I6AK47_RAT | Cstpp1 | 331 | ||
A0A8I5ZZD6 | A0A8I5ZZD6_RAT | Cstpp1 | 304 | ||
A0A8L2QM69 | A0A8L2QM69_RAT | Cstpp1 | 330 | ||
A0A8I5ZL69 | A0A8I5ZL69_RAT | Cstpp1 | 326 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC087159 EMBL· GenBank· DDBJ | AAH87159.1 EMBL· GenBank· DDBJ | mRNA |