Q5M865 · PAGR1_RAT
- ProteinPAXIP1-associated glutamate-rich protein 1
- GenePagr1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids253 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Its association with the histone methyltransferase MLL2/MLL3 complex is suggesting a role in epigenetic transcriptional activation. However, in association with PAXIP1/PTIP is proposed to function at least in part independently of the MLL2/MLL3 complex. Proposed to be recruited by PAXIP1 to sites of DNA damage where the PAGR1:PAXIP1 complex is required for cell survival in response to DNA damage independently of the MLL2/MLL3 complex. However, its function in DNA damage has been questioned. During immunoglobulin class switching in activated B-cells is involved in transcription regulation of downstream switch regions at the immunoglobulin heavy-chain (Igh) locus independently of the MLL2/MLL3 complex. Involved in both estrogen receptor-regulated gene transcription and estrogen-stimulated G1/S cell-cycle transition. Acts as a transcriptional cofactor for nuclear hormone receptors. Inhibits the induction properties of several steroid receptors such as NR3C1, AR and PPARG; the mechanism of inhibition appears to be gene-dependent.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | histone methyltransferase complex | |
Cellular Component | MLL3/4 complex | |
Cellular Component | nucleus | |
Molecular Function | nuclear estrogen receptor binding | |
Biological Process | chorion development | |
Biological Process | DNA damage response | |
Biological Process | DNA recombination | |
Biological Process | DNA repair | |
Biological Process | positive regulation of cell cycle G1/S phase transition | |
Biological Process | positive regulation of intracellular estrogen receptor signaling pathway | |
Biological Process | positive regulation of isotype switching to IgG isotypes | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of cell cycle G2/M phase transition |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePAXIP1-associated glutamate-rich protein 1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ5M865
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000248336 | 1-253 | PAXIP1-associated glutamate-rich protein 1 | |||
Sequence: MSLALGHGTIAGSTAAPLSEEGEVTSGLQALAVEDTGGPSVSASKAEEEGKGSQEEAGREASRAEEALEASSAVSDERAEGESEDWCVPCSDEEVELPANGQSWMPPPSEIQRLYELLATQGTLELQAEILPRRPPTPEAQSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKRHKKLEEQILRTGRDLFSLDSEGPSPASPPLRSSGNSLFPRQRKY | ||||||
Modified residue | 137 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 142 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 147 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 236 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Component of the KMT2 family MLL2/MLL3 complex, at least composed of the histone methyltransferases KMT2D and/or KMT2C, the common subunits ASH2L, RBBP5, WDR5 and DPY30, and the complex type-specific subunits PAXIP1/PTIP, PAGR1, NCOA6 and KDM6A; PAXIP1 is required for the association with the MLL2/MLL3 complex (By similarity).
Forms a constitutive complex with PAXIP1/PTIP independently of the MLL2/MLL3 complex. Interacts with NCOA1, ESR1, NR3C1, AR
Forms a constitutive complex with PAXIP1/PTIP independently of the MLL2/MLL3 complex. Interacts with NCOA1, ESR1, NR3C1, AR
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-108 | Disordered | ||||
Sequence: MSLALGHGTIAGSTAAPLSEEGEVTSGLQALAVEDTGGPSVSASKAEEEGKGSQEEAGREASRAEEALEASSAVSDERAEGESEDWCVPCSDEEVELPANGQSWMPPP | ||||||
Compositional bias | 48-85 | Basic and acidic residues | ||||
Sequence: EEGKGSQEEAGREASRAEEALEASSAVSDERAEGESED | ||||||
Region | 115-159 | Sufficient for interaction with NCOA1 | ||||
Sequence: YELLATQGTLELQAEILPRRPPTPEAQSEEERSDEEPEAKEEEEE | ||||||
Region | 126-253 | Disordered | ||||
Sequence: LQAEILPRRPPTPEAQSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKRHKKLEEQILRTGRDLFSLDSEGPSPASPPLRSSGNSLFPRQRKY | ||||||
Compositional bias | 156-221 | Basic and acidic residues | ||||
Sequence: EEEEKPHMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKRHKKLEEQILRTG | ||||||
Region | 160-253 | Sufficient for interaction with ESR1 | ||||
Sequence: KPHMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKRHKKLEEQILRTGRDLFSLDSEGPSPASPPLRSSGNSLFPRQRKY | ||||||
Compositional bias | 235-253 | Polar residues | ||||
Sequence: ASPPLRSSGNSLFPRQRKY |
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q5M865-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length253
- Mass (Da)27,683
- Last updated2006-09-05 v2
- ChecksumBF5C8549355D152C
Q5M865-2
- Name2
- Differences from canonical
- 161-253: Missing
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 48-85 | Basic and acidic residues | ||||
Sequence: EEGKGSQEEAGREASRAEEALEASSAVSDERAEGESED | ||||||
Compositional bias | 156-221 | Basic and acidic residues | ||||
Sequence: EEEEKPHMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKRHKKLEEQILRTG | ||||||
Alternative sequence | VSP_020244 | 161-253 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 235-253 | Polar residues | ||||
Sequence: ASPPLRSSGNSLFPRQRKY |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AABR03004725 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC088203 EMBL· GenBank· DDBJ | AAH88203.1 EMBL· GenBank· DDBJ | mRNA |