Q5H9I0 · TFDP3_HUMAN
- ProteinTranscription factor Dp family member 3
- GeneTFDP3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids405 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Competitive inhibitor of E2F-mediated transactivation activity. Impairs E2F-mediated cell-cycle progression from G1 to S phase.
Features
Showing features for dna binding, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 108-190 | |||||
Sequence: GMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNIKRRTYDALNVLMAMNIISREKKKIKWIGLT | ||||||
Site | 121 | Critical for repression of E2F activity | ||||
Sequence: T | ||||||
Site | 130 | Critical for repression of E2F activity | ||||
Sequence: C | ||||||
Site | 131 | Critical for repression of E2F activity | ||||
Sequence: Q | ||||||
Site | 140 | Critical for repression of E2F activity | ||||
Sequence: K |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Cellular Component | transcription regulator complex | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor binding | |
Molecular Function | RNA polymerase II-specific DNA-binding transcription factor binding | |
Molecular Function | transcription regulator inhibitor activity | |
Biological Process | DNA damage response | |
Biological Process | negative regulation of DNA-binding transcription factor activity | |
Biological Process | negative regulation of G1/S transition of mitotic cell cycle | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription factor Dp family member 3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ5H9I0
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 112 | No effect on down-regulation of E2F transcriptional activity; when associated with or without R-161 or with V-164. | ||||
Sequence: C → R | ||||||
Mutagenesis | 121 | Restores enhanced E2F-mediated transcriptional activity; when associated with Y-130; N-131 and E-145. | ||||
Sequence: T → K | ||||||
Mutagenesis | 130 | Restores enhanced E2F-mediated transcriptional activity; when associated with K-121; N-131 and E-145. | ||||
Sequence: C → Y | ||||||
Mutagenesis | 131 | Restores enhanced E2F-mediated transcriptional activity; when associated with K-121; Y-130 and E-145. | ||||
Sequence: Q → N | ||||||
Mutagenesis | 140 | Restores enhanced E2F-mediated transcriptional activity; when associated with K-121; Y-130 and N-131. | ||||
Sequence: K → E | ||||||
Mutagenesis | 161 | No effect on down-regulation of E2F transcriptional activity; when associated with or without R-112. | ||||
Sequence: K → R | ||||||
Mutagenesis | 164 | No effect on down-regulation of E2F transcriptional activity; when associated R-112. | ||||
Sequence: T → V |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 398 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000305940 | 1-405 | Transcription factor Dp family member 3 | |||
Sequence: MAKYVSLTEANEELKVLMDENQTSRPVAVHTSTVNPLGKQLLPKTFGQSSVNIDQQVVIGMPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNIKRRTYDALNVLMAMNIISREKKKIKWIGLTTNSAQNCQNLRVERQKRLERIKQKQSELQQLILQQIAFKNLVLRNQYVEEQVSQRPLPNSVIHVPFIIISSSKKTVINCSISDDKSEYLFKFNSSFEIHDDTEVLMWMGMTFGLESGSCSAEDLKMARNLVPKALEPYVTEMAQGTFGGVFTTAGSRSNGTWLSASDLTNIAIGMLATSSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDEDD |
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 68-104 | Disordered | ||||
Sequence: SNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKG | ||||||
Compositional bias | 73-97 | Polar residues | ||||
Sequence: VGSPNPPSTHFASQNQHSYSSPPWA | ||||||
Motif | 156-190 | DEF box | ||||
Sequence: DVKNIKRRTYDALNVLMAMNIISREKKKIKWIGLT | ||||||
Region | 175-306 | Involved in negatively regulating E2F activity | ||||
Sequence: NIISREKKKIKWIGLTTNSAQNCQNLRVERQKRLERIKQKQSELQQLILQQIAFKNLVLRNQYVEEQVSQRPLPNSVIHVPFIIISSSKKTVINCSISDDKSEYLFKFNSSFEIHDDTEVLMWMGMTFGLES | ||||||
Region | 209-241 | DCB1 | ||||
Sequence: ERIKQKQSELQQLILQQIAFKNLVLRNQYVEEQ | ||||||
Region | 254-310 | DCB2 | ||||
Sequence: VPFIIISSSKKTVINCSISDDKSEYLFKFNSSFEIHDDTEVLMWMGMTFGLESGSCS | ||||||
Region | 369-405 | Disordered | ||||
Sequence: SSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDEDD | ||||||
Compositional bias | 384-405 | Acidic residues | ||||
Sequence: AVEEEEEEDNNDDDLSENDEDD |
Domain
The potential DNA-binding domain differs in sequence from that of other DP family members and cannot bind DNA.
Sequence similarities
Belongs to the E2F/DP family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length405
- Mass (Da)44,967
- Last updated2005-02-15 v1
- ChecksumAE6F5709FE7E4C03
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 73-97 | Polar residues | ||||
Sequence: VGSPNPPSTHFASQNQHSYSSPPWA | ||||||
Compositional bias | 384-405 | Acidic residues | ||||
Sequence: AVEEEEEEDNNDDDLSENDEDD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF219119 EMBL· GenBank· DDBJ | AAF37562.2 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
Z77249 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471107 EMBL· GenBank· DDBJ | EAX11773.1 EMBL· GenBank· DDBJ | Genomic DNA |