Q5GFD5 · HS3S6_MOUSE
- ProteinHeparan sulfate glucosamine 3-O-sulfotransferase 6
- GeneHs3st6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids342 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to heparan sulfate. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.
Catalytic activity
- 3'-phosphoadenylyl sulfate + alpha-D-glucosaminyl-[heparan sulfate](n) = 3-sulfo-alpha-D-glucosaminyl-[heparan sulfate](n) + adenosine 3',5'-bisphosphate + H+
CHEBI:58339 + α-D-glucosaminyl-[heparan sulfate](n) RHEA-COMP:9830 = 3-sulfo-α-D-glucosaminyl-[heparan sulfate](n) RHEA-COMP:9831 + CHEBI:58343 + CHEBI:15378
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 100-104 | 3'-phosphoadenylyl sulfate (UniProtKB | ChEBI) | ||||
Sequence: KGGTR | ||||||
Binding site | 122-128 | substrate | ||||
Sequence: EPHFFDR | ||||||
Binding site | 153-156 | substrate | ||||
Sequence: KTPS | ||||||
Binding site | 181 | 3'-phosphoadenylyl sulfate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 189 | 3'-phosphoadenylyl sulfate (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 220-221 | substrate | ||||
Sequence: WS | ||||||
Binding site | 305-309 | 3'-phosphoadenylyl sulfate (UniProtKB | ChEBI) | ||||
Sequence: KGRPH |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi membrane | |
Molecular Function | [heparan sulfate]-glucosamine 3-sulfotransferase 1 activity | |
Biological Process | blastocyst hatching | |
Biological Process | heparan sulfate proteoglycan biosynthetic process |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHeparan sulfate glucosamine 3-O-sulfotransferase 6
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ5GFD5
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Single-pass type II membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-31 | Cytoplasmic | ||||
Sequence: MAGSGGLGGGAGDLQGAGTGQGTALRALRAP | ||||||
Transmembrane | 32-49 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: LALVVLLLSAYCLFALPG | ||||||
Topological domain | 50-342 | Lumenal | ||||
Sequence: RCPPAARAPAPVPAPAEPPHTSLRLRAPGLPVASGPGRRRFPQALIVGVKKGGTRALLEFLRLHPDVRALGSEPHFFDRCYDRGLAWYRGLMPRTLDGQITMEKTPSYFVTQEAPRRIHGMSPDTKLIVVVRNPVTRAISDYAQTLSKTPGLPSFRALAFRHGLGPVDTAWSAVRIGLYAQHLDNWLRYFPLSHFLFVSGERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGSGRPRCLGKSKGRPHPRVPEAVVQRLQAFYRPFNRKFYQMTGQDFGWD |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000085225 | 1-342 | Heparan sulfate glucosamine 3-O-sulfotransferase 6 | |||
Sequence: MAGSGGLGGGAGDLQGAGTGQGTALRALRAPLALVVLLLSAYCLFALPGRCPPAARAPAPVPAPAEPPHTSLRLRAPGLPVASGPGRRRFPQALIVGVKKGGTRALLEFLRLHPDVRALGSEPHFFDRCYDRGLAWYRGLMPRTLDGQITMEKTPSYFVTQEAPRRIHGMSPDTKLIVVVRNPVTRAISDYAQTLSKTPGLPSFRALAFRHGLGPVDTAWSAVRIGLYAQHLDNWLRYFPLSHFLFVSGERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGSGRPRCLGKSKGRPHPRVPEAVVQRLQAFYRPFNRKFYQMTGQDFGWD | ||||||
Glycosylation | 281 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 288↔300 | |||||
Sequence: CLKKAQGSGRPRC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in liver and kidney, followed by heart, brain, lung and testis.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 56-75 | Disordered | ||||
Sequence: RAPAPVPAPAEPPHTSLRLR |
Sequence similarities
Belongs to the sulfotransferase 1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length342
- Mass (Da)37,415
- Last updated2005-03-01 v1
- Checksum9FA1585916862AB7
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A3Q4L2U2 | A0A3Q4L2U2_MOUSE | Hs3st6 | 147 | ||
B7ZNT8 | B7ZNT8_MOUSE | Hs3st6 | 332 | ||
A0A3Q4EHY0 | A0A3Q4EHY0_MOUSE | Hs3st6 | 138 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY574375 EMBL· GenBank· DDBJ | AAT84072.1 EMBL· GenBank· DDBJ | mRNA |