Q5G6H1 · Q5G6H1_NYCAL

Function

function

During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS.
Important signaling molecule that activates signaling cascades downstream of NTRK2 (By similarity).
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentaxon
Cellular Componentdendrite
Cellular Componentextracellular space
Cellular Componentsynaptic vesicle
Molecular Functiongrowth factor activity
Molecular Functionnerve growth factor receptor binding
Biological Processcell surface receptor protein tyrosine kinase signaling pathway
Biological Processmemory
Biological Processmodulation of chemical synaptic transmission
Biological Processnegative regulation of neuron apoptotic process
Biological Processnerve development
Biological Processnerve growth factor signaling pathway
Biological Processneuron projection morphogenesis
Biological Processperipheral nervous system development
Biological Processpositive regulation of collateral sprouting
Biological Processpositive regulation of peptidyl-serine phosphorylation
Biological Processregulation of neuron differentiation

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Brain-derived neurotrophic factor
  • Short names
    BDNF

Gene names

    • Name
      BDNF

Organism names

  • Taxonomic identifier
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Chiroptera > Yinpterochiroptera > Pteropodoidea > Pteropodidae > Nyctimeninae > Nyctimene

Accessions

  • Primary accession
    Q5G6H1

Subcellular Location

Interaction

Subunit

Monomers and homodimers (By similarity).
Binds to NTRK2/TRKB. Can form heterodimers with other neurotrophin family members, such as NTF3 and NTF4 (in vitro), but the physiological relevance of this is not clear (By similarity).
BDNF precursor form: interacts with the heterodimer formed by NGFR and SORCS2. Mature BDNF has much lower affinity for the heterodimer formed by NGFR and SORCS2
Monomers and homodimers. Binds to NTRK2/TRKB.

Family & Domains

Features

Showing features for domain.

TypeIDPosition(s)Description
Domain122-186Nerve growth factor-related

Sequence similarities

Belongs to the NGF-beta family.

Family and domain databases

Sequence

  • Sequence status
    Fragment
  • Length
    186
  • Mass (Da)
    20,668
  • Last updated
    2005-03-01 v1
  • Checksum
    0F226E47766C2A6F
YFGCMKAAPMKEANIRGQGSLAYPGVRTHGTLESVNGPKAGSRGLTALADTFEHVIEELLDEDQKVRSHEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCR

Features

Showing features for non-terminal residue.

TypeIDPosition(s)Description
Non-terminal residue1
Non-terminal residue186

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
AY834509
EMBL· GenBank· DDBJ
AAV93034.1
EMBL· GenBank· DDBJ
Genomic DNA

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp