Q5FVI4 · CEND_RAT
- ProteinCell cycle exit and neuronal differentiation protein 1
- GeneCend1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids149 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Involved in neuronal differentiation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | mitochondrion | |
Cellular Component | vesicle | |
Biological Process | adult walking behavior | |
Biological Process | cerebellar granular layer maturation | |
Biological Process | cerebellar Purkinje cell differentiation | |
Biological Process | negative regulation of cerebellar granule cell precursor proliferation | |
Biological Process | neuron differentiation | |
Biological Process | radial glia guided migration of cerebellar granule cell |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCell cycle exit and neuronal differentiation protein 1
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ5FVI4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type IV membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-125 | Cytoplasmic | ||||
Sequence: MESRGKSASSPKPDTKVPQATAEAKATPAADGKAPLTKPVKKDAQAEKQEQPAAPGPATTKKTPAKADPVLLNNHSNLKPAPTVPAAPSSPDTTSEPKGPGDGAEEDESNTGGRGPWPCENLTPL | ||||||
Transmembrane | 126-146 | Helical; Anchor for type IV membrane protein | ||||
Sequence: LVAGGVAVATIALILGVAFLA | ||||||
Topological domain | 147-149 | Extracellular | ||||
Sequence: RKK |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000245465 | 1-149 | Cell cycle exit and neuronal differentiation protein 1 | |||
Sequence: MESRGKSASSPKPDTKVPQATAEAKATPAADGKAPLTKPVKKDAQAEKQEQPAAPGPATTKKTPAKADPVLLNNHSNLKPAPTVPAAPSSPDTTSEPKGPGDGAEEDESNTGGRGPWPCENLTPLLVAGGVAVATIALILGVAFLARKK | ||||||
Modified residue | 10 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 90 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 95 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-118 | Disordered | ||||
Sequence: MESRGKSASSPKPDTKVPQATAEAKATPAADGKAPLTKPVKKDAQAEKQEQPAAPGPATTKKTPAKADPVLLNNHSNLKPAPTVPAAPSSPDTTSEPKGPGDGAEEDESNTGGRGPWP |
Sequence similarities
Belongs to the CEND1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length149
- Mass (Da)15,043
- Last updated2005-03-01 v1
- Checksum196D56164631009F
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC089963 EMBL· GenBank· DDBJ | AAH89963.1 EMBL· GenBank· DDBJ | mRNA |