Q5EEP9 · Q5EEP9_VITVI
- ProteinSucrose-phosphate synthase
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1043 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Plays a role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation.
Catalytic activity
- beta-D-fructose 6-phosphate + UDP-alpha-D-glucose = sucrose 6(F)-phosphate + UDP + H+
Pathway
Glycan biosynthesis; sucrose biosynthesis; sucrose from D-fructose 6-phosphate and UDP-alpha-D-glucose: step 1/2.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | sucrose synthase activity | |
Molecular Function | sucrose-phosphate synthase activity | |
Biological Process | sucrose biosynthetic process |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSucrose-phosphate synthase
- EC number
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > Vitales > Vitaceae > Viteae > Vitis
Accessions
- Primary accessionQ5EEP9
Genome annotation databases
Expression
Gene expression databases
Interaction
Subunit
Homodimer or homotetramer.
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 136-165 | Basic and acidic residues | ||||
Sequence: LEREQGRHDAADDLSELSEGEKEKGDPNQI | ||||||
Region | 136-167 | Disordered | ||||
Sequence: LEREQGRHDAADDLSELSEGEKEKGDPNQIEP | ||||||
Domain | 193-452 | Sucrose synthase | ||||
Sequence: IILISIHGLVRGENMELGRDSDTGGQVKYVVELARALANTKGVYRVDLLTRQITSTEVDSSYGEPIEMLSCPSDGGGSCGAYIIRIPCGPRDRYIPKESLWPYIPEFVDGALGHIVNMARALGEQVDAGKPIWPYVIHGHYADAGEVAAHLSGALNVPMVLTGHSLGRNKFEQLLKQGRLSREDINSTYKIMRRIEAEELGLDAAEMVVTSTRQEIEEQWGLYDGFDLKLERKLRVRRRRGVSCFGRNMPRMVVIPPGMD | ||||||
Domain | 495-668 | Glycosyl transferase family 1 | ||||
Sequence: NPHKPMILALSRPDPKKNVTTLLKAFGECRQLRELANLTLILGNRDDIEEMSNSSSVVLTTALKFIDKYDLYGQVAYPKHHKQSEVPEIYRLAAKTKGVFINPALVEPFGLTLIEAAAYGLPVVATKNGGPVDIIKALNNGLLVDPHDQKGIADALLKLLADKNLWLECRKNGL | ||||||
Domain | 806-976 | Sucrose phosphatase-like | ||||
Sequence: IGFVLLTGLSLQEILEKLRCCQVNLEEIDALVCNSGSEIYYPWRDLIADLEYEAHVEYRWPGENVRSVVTRLAQGEGGAEDDIVEYAGVCSTRCYSYGVKPGAKTRRIDDLHQRMRMRGFRCNLVYTHATSRLNVVPLFASRAQALRYLSVRWGIDLSKMVVFVGEKGDTD |
Sequence similarities
Belongs to the glycosyltransferase 1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,043
- Mass (Da)117,930
- Last updated2005-03-15 v1
- ChecksumFE24A4CA42CF1EB4
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 136-165 | Basic and acidic residues | ||||
Sequence: LEREQGRHDAADDLSELSEGEKEKGDPNQI |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY899999 EMBL· GenBank· DDBJ | AAW82754.1 EMBL· GenBank· DDBJ | mRNA |