Q5DTT3 · TASO2_MOUSE
- ProteinProtein TASOR 2
- GeneTasor2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids2382 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Biological Process | negative regulation of gene expression, epigenetic |
Names & Taxonomy
Protein names
- Recommended nameProtein TASOR 2
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ5DTT3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain, modified residue, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000299543 | 1-2382 | Protein TASOR 2 | |||
Sequence: MAAPTSKIILELNKNALISPWKGQFIIQGCLLCDITLWSTYGTVVPLQLPRELDFKYVMDVSSLKESLPEAAFRRRSYLEQKVCCQDLCFDLYEVELTNKQGENIDKLMEYVKNKELALIKCLEDKSFFILFTSSALTPEPGFGAEQMGLHGLHLFHAPQTAGAKDLKVEDGISLKVIPILPALSYALLEAKKSLSEEGIPPNILVKHSFQELYKVDKSLSLMAPPQDGVEDTASTGKLSHAFDLPPPLETCPSESLTHLKCYFSDPAGYTLDLSAALDLLAEHPQFPCIADGVCDAGFSLVMTPDPEFLDSEMEIRKTETAEKSGRKLKVKKKAVTPSSNQRVQPKRKASTTAVTLPSKRVSLGRPTSKRTVPRTDNRSCNPTLKLVKGQFPQKRKRGAEVLAAQIVQKTRLERKKQEASVSKDAPVPTNTKRAKKQEKSPGRIASQPKPPMKKSPQKRKVNVARGRRNTRKQLQPAEKEIALHLQSEISSDGQKDGLNLSTSQQESISMIPKGPPENSVISCDSQALNMLADLALSSAAASIPSCKPRNLPCVSDLPRNNVLLTKENPLLGASDHEYHKGVKSQKAVLLPKPYSDEKISSESDLTRSQEENLVPCAQPLPIAQPAPHSEARELSDASQNSVVVEHSYALLLAEQSQKHLHQRKLPSPAFVKNGIKGPEAGTPVGKVMPFRHLQNTSPLQKHSEDSLMKHKSLFVSSTLKEFFCSHTVLKCDGSFKITFKCEGEYVFSLDSKYTSNPLEKTVLRALHGPWNTDLPENVDDVKLLLHIWVALFYSKNNKVIGSPRKVVEHKNPAKYVCINRSLESLDHSEIEAFSNVERPSVEGSVDPLLETKETHIGHATNMTFPGPNRVLPFINPPTTRDLELCVQNDQKEVFTGECHLDTSGNQNFIYSCNTEVTGGKTKQELSNKLETSNVVLSGVVSAQSHGTCIPSEDKTCQSTKMVSYNDSVTQATLTTAYDEASSELMCQKSVFDNLENKVDSFHPSPLIKTDAVQDVIQHSSHINNECQPSVEKREDNVECMMVNLDPVTLAFEKNASVPIHTEVHTTDKPTGFNIELVKRVSPASSVQYPMSALEEVQTQSSRDVPSLAMSEYKDSKCLSASSVKKETPPESLCLLQKEIPPLTSSADEGLIMEALSLVKSSSYSLASDKTKCPQDDSLQTQNGLSMSLDEVLEPSKVNVVSSTSVTLREQPSPNCIPAMSDVAGASTVIMNSGSSSLNQEKILQTFSLVFPKQTDLSLKREEVSMELSGEEADINLTLTISPPTSPSEEIAAGEIEQFQKTPVSNVGQQSRSEEMVEPEEEERLIRNREINSASCMSVYPVESRELLKNCTPEVTEKVNVTLDFPFGPLIEVSPASSPDPIVQPGDRPSSPCCLKLHSSQSEKTNKFSQIKSGEVTIPEKESLFLGPESPKGQDKLAEVQVQISAEMLQITTNAEVEGRVNMPGKVTKVSVPSEHSENLSFLEKVQCNTELNELSLPAKYGGNFKPLEKSGNSLEAGCMENRNVDVKHLALESSVPSCSPRKVVENKSLTDTLVSITTSGIVNMSLKQTSSKNIKKNVCDSDVKTDSDVKTEADSNMQTEAVNSALIDKTDVQAYSHPEVSKFVSSSDSAQCTYHAKPVSVEPGFQTQEIPVVRMASLLKNIGVELHEEKMDLSATGLQSNSMSAKDEQKTMHVLQDTICEVKEFLNGDVFSQNAHSCQNTVDFSKSISEEPSASFVPEFVDAICGVYKEHTFNESPNMVHETKADAETLSRNTEISVNASMFCGPRSGAYVQDSHDCKSCKFDVENLRGNHESQKDAVKDSCDSFTSLNNSDDTWACSSKISTLETHIPPRDQETEPRLISPNKCIPRYIQIPDSHGIPKTYANFTITKEFKDTTRRLHSLKRHRNLSANCNLLSSWTSTWHVTDDLTQHTLDLEYLRFDHKLKQIKKGGSQQSSFPKESLVQISSGTSPSTQTSEASGLHLPPESRSPILVTVVRADTRQQSHHRRGCSPSSLDGSSSFWKKKCSQSRNLKNSERSQTVPFHLNKLKYNSTLKESRNDISLILNEYAEFNKIMMNSKQIVSQDEELNVASAEAVFQEAYQPRQPVSYEDVITDLCATLHVKLKGVVREACKSPFWFYLVETEDKSFLLRTKSILKKGGHIEIELLDFCQAFHRENETLLVIIKNEDIISHLHQIPSLLKLKHFPSVVFAGVDSPEDIVNETYQELFRSGGFVVSDDVILESLTLVQLKEILKILEKLNENGKWKWLLHYRESKNLKEDVRVDSIAHKKNLILKSYQSVNIIDLLHYHNCDSPSSTKAEIFKCLLNLQIQHISARFAVFLTDKPTVSTEIFENNGILVTDVNYFTENIQKIAAPFRSSYW | ||||||
Modified residue | 19 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 219 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1021 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1082 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1430 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1540 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 1960 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 1962 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1990 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 2012 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 2015 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 2019 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 320-384 | Disordered | ||||
Sequence: ETAEKSGRKLKVKKKAVTPSSNQRVQPKRKASTTAVTLPSKRVSLGRPTSKRTVPRTDNRSCNPT | ||||||
Compositional bias | 335-384 | Polar residues | ||||
Sequence: AVTPSSNQRVQPKRKASTTAVTLPSKRVSLGRPTSKRTVPRTDNRSCNPT | ||||||
Region | 412-478 | Disordered | ||||
Sequence: RLERKKQEASVSKDAPVPTNTKRAKKQEKSPGRIASQPKPPMKKSPQKRKVNVARGRRNTRKQLQPA | ||||||
Compositional bias | 454-468 | Basic residues | ||||
Sequence: KKSPQKRKVNVARGR | ||||||
Region | 620-639 | Disordered | ||||
Sequence: PLPIAQPAPHSEARELSDAS | ||||||
Region | 1301-1324 | Disordered | ||||
Sequence: KTPVSNVGQQSRSEEMVEPEEEER | ||||||
Region | 1949-1987 | Disordered | ||||
Sequence: KKGGSQQSSFPKESLVQISSGTSPSTQTSEASGLHLPPE | ||||||
Compositional bias | 1950-1983 | Polar residues | ||||
Sequence: KGGSQQSSFPKESLVQISSGTSPSTQTSEASGLH | ||||||
Region | 2000-2021 | Disordered | ||||
Sequence: DTRQQSHHRRGCSPSSLDGSSS |
Sequence similarities
Belongs to the TASOR family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length2,382
- Mass (Da)264,278
- Last updated2007-09-11 v2
- ChecksumC903BC7139AAA200
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1Y7VM81 | A0A1Y7VM81_MOUSE | Tasor2 | 51 | ||
A0A1Y7VLA4 | A0A1Y7VLA4_MOUSE | Tasor2 | 1701 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 335-384 | Polar residues | ||||
Sequence: AVTPSSNQRVQPKRKASTTAVTLPSKRVSLGRPTSKRTVPRTDNRSCNPT | ||||||
Sequence conflict | 413 | in Ref. 3; BAE23554 | ||||
Sequence: L → P | ||||||
Sequence conflict | 449 | in Ref. 4; AAB71190 | ||||
Sequence: P → S | ||||||
Compositional bias | 454-468 | Basic residues | ||||
Sequence: KKSPQKRKVNVARGR | ||||||
Compositional bias | 1950-1983 | Polar residues | ||||
Sequence: KGGSQQSSFPKESLVQISSGTSPSTQTSEASGLH |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK220437 EMBL· GenBank· DDBJ | BAD90477.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC016423 EMBL· GenBank· DDBJ | AAH16423.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC045617 EMBL· GenBank· DDBJ | AAH45617.1 EMBL· GenBank· DDBJ | mRNA | ||
BC075685 EMBL· GenBank· DDBJ | AAH75685.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
BC085160 EMBL· GenBank· DDBJ | AAH85160.1 EMBL· GenBank· DDBJ | mRNA | ||
AK128934 EMBL· GenBank· DDBJ | BAC87659.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK138119 EMBL· GenBank· DDBJ | BAE23554.1 EMBL· GenBank· DDBJ | mRNA | ||
AF020338 EMBL· GenBank· DDBJ | AAB71190.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |