Q5BJF6 · ODFP2_HUMAN
- ProteinOuter dense fiber protein 2
- GeneODF2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids829 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | centriolar subdistal appendage | |
Cellular Component | centriole | |
Cellular Component | centrosome | |
Cellular Component | ciliary basal body | |
Cellular Component | cilium | |
Cellular Component | cytosol | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | microtubule | |
Cellular Component | nucleus | |
Cellular Component | sperm flagellum | |
Cellular Component | sperm midpiece | |
Cellular Component | sperm principal piece | |
Cellular Component | spindle pole | |
Molecular Function | small GTPase binding | |
Molecular Function | structural molecule activity | |
Biological Process | cell differentiation | |
Biological Process | centriole-centriole cohesion | |
Biological Process | cilium organization | |
Biological Process | protein localization | |
Biological Process | regulation of cilium assembly | |
Biological Process | spermatogenesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameOuter dense fiber protein 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ5BJF6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localized at the microtubule organizing centers in interphase and spindle poles in mitosis. Localized at the distal/subdistal appendages of mother centrioles.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_034821 | 710 | in dbSNP:rs16930426 | |||
Sequence: T → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 912 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data), cross-link.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000299455 | 1-829 | UniProt | Outer dense fiber protein 2 | |||
Sequence: MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPPGKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYVAEALSTLESWRSRYNQVVKEKGDLELEIIVLNDRVTDLVNQQQTLEEKMREDRDSLVERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPPA | |||||||
Modified residue | 73 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 74 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 92 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 92 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 95 | UniProt | Phosphoserine; by TSSK4 | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 95 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 106 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 106 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 109 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 109 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 110 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 110 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 115 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 115 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 129 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 129 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 138 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 139 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 231 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 261 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 632 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 819 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 820 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 824 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 826 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Tyrosine phosphorylated. Phosphorylated by TSSK4 on Ser-95.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Testis-specific (at protein level). Highly expressed in cytoplasm of step 2 round spermatids. Detected in the middle piece and extends to about half the principal piece of the sperm tails.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Self-associates. Associates with microtubules and forms a fibrillar structure partially linked to the microtubule network. Interacts via its C-terminus with PLK1 (PubMed:16966375).
Interacts with ODF1 (By similarity).
Interacts with MARK4; the interaction is required for localization of ODF2 to centrioles (PubMed:23400999).
Interacts with TSSK4 (By similarity).
Interacts with AKNA (By similarity).
Interacts with QRICH2 (PubMed:30683861).
Interacts with CFAP58 (By similarity).
Interacts with BBOF1 (By similarity).
Interacts with CCDC38 (By similarity).
Interacts with CCDC42 (By similarity).
Interacts with ODF1 (By similarity).
Interacts with MARK4; the interaction is required for localization of ODF2 to centrioles (PubMed:23400999).
Interacts with TSSK4 (By similarity).
Interacts with AKNA (By similarity).
Interacts with QRICH2 (PubMed:30683861).
Interacts with CFAP58 (By similarity).
Interacts with BBOF1 (By similarity).
Interacts with CCDC38 (By similarity).
Interacts with CCDC42 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q5BJF6 | CCDC120 Q96HB5 | 5 | EBI-8744243, EBI-744556 | |
BINARY | Q5BJF6 | NUFIP2 Q7Z417 | 3 | EBI-8744243, EBI-1210753 | |
BINARY | Q5BJF6-2 | CHAT P28329-3 | 3 | EBI-9090919, EBI-25837549 | |
BINARY | Q5BJF6-2 | FGFR3 P22607 | 3 | EBI-9090919, EBI-348399 | |
BINARY | Q5BJF6-2 | GRIN2C Q14957 | 3 | EBI-9090919, EBI-8285963 | |
BINARY | Q5BJF6-2 | HSPB1 P04792 | 3 | EBI-9090919, EBI-352682 | |
BINARY | Q5BJF6-2 | ING5 Q8WYH8 | 3 | EBI-9090919, EBI-488533 | |
BINARY | Q5BJF6-2 | KIF1B O60333-2 | 3 | EBI-9090919, EBI-10975473 | |
BINARY | Q5BJF6-2 | MEOX2 Q6FHY5 | 3 | EBI-9090919, EBI-16439278 | |
BINARY | Q5BJF6-2 | RNF11 Q9Y3C5 | 3 | EBI-9090919, EBI-396669 | |
BINARY | Q5BJF6-2 | SNW1 Q13573 | 3 | EBI-9090919, EBI-632715 | |
BINARY | Q5BJF6-2 | SPRED1 Q7Z699 | 3 | EBI-9090919, EBI-5235340 | |
BINARY | Q5BJF6-2 | TRAF5 O00463 | 3 | EBI-9090919, EBI-523498 | |
BINARY | Q5BJF6-2 | WFS1 O76024 | 3 | EBI-9090919, EBI-720609 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for coiled coil, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 144-217 | |||||
Sequence: QKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMD | ||||||
Coiled coil | 245-423 | |||||
Sequence: DINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQL | ||||||
Region | 392-413 | Disordered | ||||
Sequence: KQKGDRDKESLKKAIRAQKERA | ||||||
Coiled coil | 461-798 | |||||
Sequence: EIIVLNDRVTDLVNQQQTLEEKMREDRDSLVERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQ | ||||||
Region | 537-701 | Interaction with BBOF1 | ||||
Sequence: KNYEGMIDNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRL |
Sequence similarities
Belongs to the ODF2 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 10 isoforms produced by Alternative splicing.
Q5BJF6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length829
- Mass (Da)95,401
- Last updated2005-04-12 v1
- ChecksumCF49166AD9003BEB
Q5BJF6-2
- Name2
Q5BJF6-3
- Name3
- SynonymsCenexin 1
Q5BJF6-4
- Name4
- SynonymsCenexin 1 variant 1
- Differences from canonical
- 1-41: MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVT → MKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQ
Q5BJF6-5
- Name5
- SynonymsCenexin 1, ODF2/1
- NoteMajor.
Q5BJF6-6
- Name6
- SynonymsIsoform 3, ODF2/2
Q5BJF6-7
- Name7
Q5BJF6-8
- Name8
Q5BJF6-9
- Name9
Q5BJF6-10
- Name10
Computationally mapped potential isoform sequences
There are 11 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q5T4C3 | Q5T4C3_HUMAN | ODF2 | 386 | ||
Q5T4C6 | Q5T4C6_HUMAN | ODF2 | 205 | ||
Q5T4C8 | Q5T4C8_HUMAN | ODF2 | 156 | ||
A0A8J8Z1C3 | A0A8J8Z1C3_HUMAN | ODF2 | 893 | ||
A0A8J8YVX4 | A0A8J8YVX4_HUMAN | ODF2 | 912 | ||
S4R3R9 | S4R3R9_HUMAN | ODF2 | 241 | ||
S4R411 | S4R411_HUMAN | ODF2 | 144 | ||
S4R462 | S4R462_HUMAN | ODF2 | 100 | ||
A0A8I5KUN7 | A0A8I5KUN7_HUMAN | ODF2 | 25 | ||
A0A8I5KWC9 | A0A8I5KWC9_HUMAN | ODF2 | 90 | ||
A0A8J8ZBD8 | A0A8J8ZBD8_HUMAN | ODF2 | 115 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_044946 | 1-10 | in isoform 10 | |||
Sequence: MSASSSGGSP → MADQQGPHQN | ||||||
Alternative sequence | VSP_042071 | 1-11 | in isoform 7 | |||
Sequence: MSASSSGGSPR → MGELPTGCRKRRRKRGGAAARARLHPPRRLHGTTLASDFNDFIRRRFWAQPCRSW | ||||||
Alternative sequence | VSP_042070 | 1-11 | in isoform 8 | |||
Sequence: MSASSSGGSPR → MGRNRYPPACW | ||||||
Alternative sequence | VSP_027666 | 1-41 | in isoform 3, isoform 4 and isoform 9 | |||
Sequence: MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVT → MKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQ | ||||||
Alternative sequence | VSP_027665 | 1-47 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 39 | in Ref. 3; AAP83847 | ||||
Sequence: T → A | ||||||
Alternative sequence | VSP_027667 | 65-83 | in isoform 2, isoform 3, isoform 5 and isoform 8 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_042072 | 65-140 | in isoform 9 | |||
Sequence: Missing | ||||||
Sequence conflict | 194 | in Ref. 3; AAP83847 | ||||
Sequence: I → R | ||||||
Alternative sequence | VSP_027668 | 638-657 | in isoform 5, isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10 | |||
Sequence: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR | ||||||
Alternative sequence | VSP_027669 | 658-829 | in isoform 5, isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF012549 EMBL· GenBank· DDBJ | AAB66337.1 EMBL· GenBank· DDBJ | mRNA | ||
AF053970 EMBL· GenBank· DDBJ | AAC08409.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
DQ444713 EMBL· GenBank· DDBJ | ABE01856.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ444714 EMBL· GenBank· DDBJ | ABE01857.1 EMBL· GenBank· DDBJ | mRNA | ||
AY319414 EMBL· GenBank· DDBJ | AAP83847.1 EMBL· GenBank· DDBJ | mRNA | ||
AY366499 EMBL· GenBank· DDBJ | AAQ73195.1 EMBL· GenBank· DDBJ | mRNA | ||
AK299303 EMBL· GenBank· DDBJ | BAG61316.1 EMBL· GenBank· DDBJ | mRNA | ||
AK301842 EMBL· GenBank· DDBJ | BAG63285.1 EMBL· GenBank· DDBJ | mRNA | ||
AK302684 EMBL· GenBank· DDBJ | BAG63914.1 EMBL· GenBank· DDBJ | mRNA | ||
AL359091 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL445287 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471090 EMBL· GenBank· DDBJ | EAW87791.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471090 EMBL· GenBank· DDBJ | EAW87793.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471090 EMBL· GenBank· DDBJ | EAW87795.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC091500 EMBL· GenBank· DDBJ | AAH91500.1 EMBL· GenBank· DDBJ | mRNA | ||
BC010629 EMBL· GenBank· DDBJ | AAH10629.1 EMBL· GenBank· DDBJ | mRNA |