Q5AVM1 · DBP5_EMENI
- ProteinATP-dependent RNA helicase dbp5
- Genedbp5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids477 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
ATP-dependent RNA helicase associated with the nuclear pore complex and essential for mRNA export from the nucleus. May participate in a terminal step of mRNA export through the removal of proteins that accompany mRNA through the nucleopore complex. May also be involved in early transcription (By similarity).
Catalytic activity
- ATP + H2O = ADP + H+ + phosphate
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cellular bud tip | |
Cellular Component | cytoplasmic stress granule | |
Cellular Component | nuclear membrane | |
Cellular Component | nuclear pore cytoplasmic filaments | |
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | inositol hexakisphosphate binding | |
Molecular Function | mRNA binding | |
Molecular Function | RNA helicase activity | |
Biological Process | poly(A)+ mRNA export from nucleus | |
Biological Process | protein transport | |
Biological Process | translational termination | |
Biological Process | tRNA export from nucleus |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameATP-dependent RNA helicase dbp5
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Eurotiomycetes > Eurotiomycetidae > Eurotiales > Aspergillaceae > Aspergillus > Aspergillus subgen. Nidulantes
Accessions
- Primary accessionQ5AVM1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Nucleus membrane ; Peripheral membrane protein
Note: Nuclear pore complex cytoplasmic fibrils.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000232223 | 1-477 | ATP-dependent RNA helicase dbp5 | |||
Sequence: MASDAPTGGSLADRISNPAETTEPVADKAQLDGAASNQGGSDLAEPEYNVEVKLSDLQADPNNPLYSVKNFEDLGLDPRILQGLSAMNFRKPSKIQERALPLLMGNPPKNLVGQSQSGTGKTAAFVLNILSRLDLSSEQAQKTPQALILAPTRELARQIVGVIQVMGKFLDGLHIGTAVPADTNARPTRMEASVVVGTPGTVMDMIKKRIMVAAKLKVIVLDEADNMLDQQGLGDQCIRVKALLPRDIQVVLFSATFPAHVHQYASKFAPAANELTLQHEELTVEGIKQLYLDCASEEDKYRTLVQLYGLLTVGSSIIFVKTRASAVEIERRMVAEGHTVASLTGGIEGSQRDQIIDQFRAGHAKVLITTNVLARGIDVSTVSMVINYDIPELHQPPNRPRQADFQTYLHRIGRTGRFGRVGVSISFVSNREEWEMLNQIQKYFNTDIQRIDTKDWDEVEDIIKKTIKNTRAQAGFR |
Interaction
Structure
Family & Domains
Features
Showing features for region, motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-43 | Disordered | ||||
Sequence: MASDAPTGGSLADRISNPAETTEPVADKAQLDGAASNQGGSDL | ||||||
Motif | 69-97 | Q motif | ||||
Sequence: KNFEDLGLDPRILQGLSAMNFRKPSKIQE | ||||||
Domain | 102-275 | Helicase ATP-binding | ||||
Sequence: LLMGNPPKNLVGQSQSGTGKTAAFVLNILSRLDLSSEQAQKTPQALILAPTRELARQIVGVIQVMGKFLDGLHIGTAVPADTNARPTRMEASVVVGTPGTVMDMIKKRIMVAAKLKVIVLDEADNMLDQQGLGDQCIRVKALLPRDIQVVLFSATFPAHVHQYASKFAPAANEL | ||||||
Motif | 222-225 | DEAD box | ||||
Sequence: DEAD | ||||||
Domain | 303-459 | Helicase C-terminal | ||||
Sequence: TLVQLYGLLTVGSSIIFVKTRASAVEIERRMVAEGHTVASLTGGIEGSQRDQIIDQFRAGHAKVLITTNVLARGIDVSTVSMVINYDIPELHQPPNRPRQADFQTYLHRIGRTGRFGRVGVSISFVSNREEWEMLNQIQKYFNTDIQRIDTKDWDEV |
Domain
The Q motif is unique to and characteristic of the DEAD box family of RNA helicases and controls ATP binding and hydrolysis.
Sequence similarities
Belongs to the DEAD box helicase family. DDX19/DBP5 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length477
- Mass (Da)52,392
- Last updated2005-04-26 v1
- Checksum06CBE4E2B09424A5
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AACD01000130 EMBL· GenBank· DDBJ | EAA61845.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BN001304 EMBL· GenBank· DDBJ | CBF79845.1 EMBL· GenBank· DDBJ | Genomic DNA |