Q5AFP3 · MCM1_CANAL
- ProteinTranscription factor of morphogenesis MCM1
- GeneMCM1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids262 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor that is recruited by AHR1 to the promoters of genes involved in biofilm formation, which include several key adhesion genes. Plays an important role in cell adhesion, hyphal growth and virulence. Implicated in the regulation of opaque-phase-specific gene expression.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | protein dimerization activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | cell adhesion | |
Biological Process | filamentous growth | |
Biological Process | filamentous growth of a population of unicellular organisms | |
Biological Process | positive regulation of pseudohyphal growth by positive regulation of transcription from RNA polymerase II promoter | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of pseudohyphal growth |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTranscription factor of morphogenesis MCM1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Debaryomycetaceae > Candida/Lodderomyces clade > Candida
Accessions
- Primary accessionQ5AFP3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000420187 | 1-262 | Transcription factor of morphogenesis MCM1 | |||
Sequence: MAIKEETNEFSQGNEGNSHSTNNNNNSNNSNSNNNADVSAPVDDDDDDDGTSQGKTQKERRKIEIKFIQEKSRRHITFSKRKAGIMKKAYELSVLTGTQVLLLVVSETGLVYTFTTPKLQPLVTKSEGKNLIQACLNAPEEGLGDDQENQSDGNTGDSPDQSPAPATNPNVMGAAGHAHHIQQQQQQQQQAQQQAQQQMAPMPSHGLPTHYSNPQGAGNPGVPPQQQGQHQPGIPLQGGYSDQYSYFGNIQNNNIPNQQQYQ |
Expression
Induction
Expression is high in white-phase cells and low in opaque-phase cells.
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-62 | Disordered | ||||
Sequence: MAIKEETNEFSQGNEGNSHSTNNNNNSNNSNSNNNADVSAPVDDDDDDDGTSQGKTQKERRK | ||||||
Compositional bias | 7-39 | Polar residues | ||||
Sequence: TNEFSQGNEGNSHSTNNNNNSNNSNSNNNADVS | ||||||
Domain | 58-118 | MADS-box | ||||
Sequence: KERRKIEIKFIQEKSRRHITFSKRKAGIMKKAYELSVLTGTQVLLLVVSETGLVYTFTTPK | ||||||
Region | 140-262 | Disordered | ||||
Sequence: EEGLGDDQENQSDGNTGDSPDQSPAPATNPNVMGAAGHAHHIQQQQQQQQQAQQQAQQQMAPMPSHGLPTHYSNPQGAGNPGVPPQQQGQHQPGIPLQGGYSDQYSYFGNIQNNNIPNQQQYQ | ||||||
Compositional bias | 148-168 | Polar residues | ||||
Sequence: ENQSDGNTGDSPDQSPAPATN | ||||||
Compositional bias | 179-262 | Polar residues | ||||
Sequence: HHIQQQQQQQQQAQQQAQQQMAPMPSHGLPTHYSNPQGAGNPGVPPQQQGQHQPGIPLQGGYSDQYSYFGNIQNNNIPNQQQYQ |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length262
- Mass (Da)28,602
- Last updated2005-04-26 v1
- ChecksumB65C5976BDBFDB08
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 7-39 | Polar residues | ||||
Sequence: TNEFSQGNEGNSHSTNNNNNSNNSNSNNNADVS | ||||||
Compositional bias | 148-168 | Polar residues | ||||
Sequence: ENQSDGNTGDSPDQSPAPATN | ||||||
Compositional bias | 179-262 | Polar residues | ||||
Sequence: HHIQQQQQQQQQAQQQAQQQMAPMPSHGLPTHYSNPQGAGNPGVPPQQQGQHQPGIPLQGGYSDQYSYFGNIQNNNIPNQQQYQ |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP017629 EMBL· GenBank· DDBJ | AOW30465.1 EMBL· GenBank· DDBJ | Genomic DNA |