Q5ABS1 · QCR7_CANAL
- ProteinCytochrome b-c1 complex subunit 7, mitochondrial
- GeneQCR7
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids127 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation (PubMed:34525326, PubMed:36923588).
Plays an important role in the uptake of multiple carbon sources such acetate, lactate, amino acids or GlcNAc present in different host niches (PubMed:36923588).
Plays an important role in the uptake of multiple carbon sources such acetate, lactate, amino acids or GlcNAc present in different host niches (PubMed:36923588).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | matrix side of mitochondrial inner membrane | |
Cellular Component | mitochondrial respiratory chain complex III | |
Cellular Component | plasma membrane | |
Molecular Function | ubiquinol-cytochrome-c reductase activity | |
Biological Process | mitochondrial electron transport, ubiquinol to cytochrome c | |
Biological Process | mitochondrial respiratory chain complex III assembly | |
Biological Process | regulation of filamentous growth |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCytochrome b-c1 complex subunit 7, mitochondrial
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Debaryomycetaceae > Candida/Lodderomyces clade > Candida
Accessions
- Primary accessionQ5ABS1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Peripheral membrane protein
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Reduces recruitment of inflammatory cells and attenuates the virulence of C.albicans infection in vivo (PubMed:36923588).
Leads to mitochondrial dysfunction and shows defects in biofilm formation or the maintenance of filamentous growth (PubMed:36923588).
Leads to decreased vegetative growth on several carbon sources including maltose, citrate and acetate (PubMed:36923588).
Leads to mitochondrial dysfunction and shows defects in biofilm formation or the maintenance of filamentous growth (PubMed:36923588).
Leads to decreased vegetative growth on several carbon sources including maltose, citrate and acetate (PubMed:36923588).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000459231 | 1-127 | Cytochrome b-c1 complex subunit 7, mitochondrial | |||
Sequence: MVQSMTSVVKAANFILARPTLSKIITPLAQKFTAYAGYREMGLKFNDLLLEETPIMQTAIKRLPSELNYSRNFRILTAHQLALSHQLLPAEKAVKPEEDDNYLIPYILEAEKEAFEKAELDNIEVKA |
Expression
Induction
Expression is repressed by HAP43.
Interaction
Subunit
Component of the ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), a multisubunit enzyme composed of 10 subunits. The complex is composed of 3 respiratory subunits cytochrome b (COB), cytochrome c1 (CYT1) and Rieske protein (RIP1), 2 core protein subunits COR1 and QCR2, and 5 low-molecular weight protein subunits QCR6, QCR7, QCR8, QCR9 and QCR10. The complex exists as an obligatory dimer and forms supercomplexes (SCs) in the inner mitochondrial membrane with a monomer or a dimer of cytochrome c oxidase (complex IV, CIV), resulting in 2 different assemblies (supercomplexes III2IV and III2IV2).
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length127
- Mass (Da)14,424
- Last updated2005-04-26 v1
- Checksum755D527CF3234865
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP017628 EMBL· GenBank· DDBJ | AOW30270.1 EMBL· GenBank· DDBJ | Genomic DNA |