Q5ABA6 · ATG18_CANAL
- ProteinAutophagy-related protein 18
- GeneATG18
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids558 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
function
The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Necessary for proper vacuole morphology. Plays an important role in osmotically-induced vacuole fragmentation. Required for cytoplasm to vacuole transport (Cvt) vesicle formation, pexophagy and starvation-induced autophagy. Involved in correct ATG9 trafficking to the pre-autophagosomal structure. Might also be involved in premeiotic DNA replication (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAutophagy-related protein 18
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Debaryomycetaceae > Candida/Lodderomyces clade > Candida
Accessions
- Primary accessionQ5ABA6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Preautophagosomal structure membrane ; Peripheral membrane protein
Vacuole membrane ; Peripheral membrane protein
Endosome membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000050862 | 1-558 | Autophagy-related protein 18 | |||
Sequence: MLQTSSSSATASLQQQLSKQYANSFSNDGSSFSSKNNQQYSEIVNYISFNQDASCITIGLKNGYKIFNCQPNFGRSFQFKNDESTGIVEMLYCTSLLATVAQGEEIGSSPRKLKIINTKTKSTICDLIFPSTILQVKLTNTRLIVVLEDQIYLYDITTMKLLHTIETSPNLSGLSAISYDDSNSYLAYPSPPKTITHDSLLASGINTNGGSNSTQNNISSVSNTPNRVGDVIIFNLTSLQPISVIEAHKSTIASMAFSNNGLYLATASDKGTIVRIFEVATGTKLYQFRRGTYPTKIYSLRFSADDKYVLATSSSLTVHIFRLGEEEALETKHKKKKIPAVATILEEETEGSQSNEQTKSIKRNSEEFEDIRDDGDDSDVDDEDGDIDDESLEVIPAKQRKLSQGSTNSYTSVNSEDVQSNSPKTEPLIDQNRLSMARIIRRSSQTLGRKAAQKMGDFLPSRFSSILEPTRNFASLKINAHSKDTKSVAVMNNVLQQDLIPQTYLASDNASAKQDFMEVSLFHIYVVTTEGMLYTYGLDPERGGDCILLNSHCILDEY |
Interaction
Structure
Family & Domains
Features
Showing features for repeat, motif, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 247-287 | WD 1 | ||||
Sequence: AHKSTIASMAFSNNGLYLATASDKGTIVRIFEVATGTKLYQ | ||||||
Motif | 288-292 | L/FRRG motif | ||||
Sequence: FRRGT | ||||||
Repeat | 292-331 | WD 2 | ||||
Sequence: TYPTKIYSLRFSADDKYVLATSSSLTVHIFRLGEEEALET | ||||||
Region | 344-426 | Disordered | ||||
Sequence: ILEEETEGSQSNEQTKSIKRNSEEFEDIRDDGDDSDVDDEDGDIDDESLEVIPAKQRKLSQGSTNSYTSVNSEDVQSNSPKTE | ||||||
Compositional bias | 370-390 | Acidic residues | ||||
Sequence: DIRDDGDDSDVDDEDGDIDDE | ||||||
Compositional bias | 400-426 | Polar residues | ||||
Sequence: RKLSQGSTNSYTSVNSEDVQSNSPKTE |
Domain
The N-terminus might form a beta-propeller domain involved in specific binding to phosphatidylinositol 3,5-bisphosphate (PIP2), leading to the association of the protein to the membrane.
The L/FRRG motif is essential for the cytoplasm to vacuole transport (Cvt) pathway, for the recruitment of ATG8 and ATG16 to the PAS in nutrient-rich medium, and for its recruitment to and dissociation from the PAS under starvation conditions.
Sequence similarities
Belongs to the WD repeat PROPPIN family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length558
- Mass (Da)61,694
- Last updated2017-04-12 v2
- ChecksumF9293487492E473C
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 370-390 | Acidic residues | ||||
Sequence: DIRDDGDDSDVDDEDGDIDDE | ||||||
Compositional bias | 400-426 | Polar residues | ||||
Sequence: RKLSQGSTNSYTSVNSEDVQSNSPKTE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP017623 EMBL· GenBank· DDBJ | AOW25741.1 EMBL· GenBank· DDBJ | Genomic DNA |