Q58CX2 · FAKD3_BOVIN
- ProteinFAST kinase domain-containing protein 3, mitochondrial
- GeneFASTKD3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids660 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Required for normal mitochondrial respiration. Increases steady-state levels and half-lives of a subset of mature mitochondrial mRNAs MT-ND2, MT-ND3, MT-CYTB, MT-CO2, and MT-ATP8/6. Promotes MT-CO1 mRNA translation and increases mitochondrial complex IV assembly and activity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial matrix | |
Cellular Component | mitochondrion | |
Cellular Component | ribonucleoprotein granule | |
Molecular Function | RNA binding | |
Biological Process | mitochondrial cytochrome c oxidase assembly | |
Biological Process | mitochondrial RNA processing | |
Biological Process | positive regulation of mitochondrial translation | |
Biological Process | regulation of mitochondrial mRNA stability |
Names & Taxonomy
Protein names
- Recommended nameFAST kinase domain-containing protein 3, mitochondrial
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos
Accessions
- Primary accessionQ58CX2
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-57 | Mitochondrion | ||||
Sequence: MALVTLRRNLYHLSDFRIHGALAALKTQQVNHVHKTVKEHLCPWFWSQHPGPIRVRF | ||||||
Chain | PRO_0000284714 | 58-660 | FAST kinase domain-containing protein 3, mitochondrial | |||
Sequence: HHAHCKKFHSENGNDLHPVGEPGFSQVHNWDRFEHSVKNVDEQMFYRKLNSFTSSGEILRFVSTLETLPDTMMAGALHRICEVERKDGDQRLPKEILESSAFQALCDRFGRDPSDLSNAGLVTAFQALTLLCGDPQSHLLMNLEAECQHRLERGGLDVHSLCILGETLIKLHGPGCSTLDLIIYQLQGESLETFTPEDIVTVYRLLQASPEKADQQQRFLNKINHFSLSLVSNLSPKLMSQMLTALVVLDQTQALPLVIKLSKYVVRHIARFTSEELRKVLEALIYFGHSDRFFTETLEQHVASLCLTLDPELVSRVMEYCSRKLILSEPIFNAVAETFVCQAEKFSPSQTAKLIEPFGKLNYLPPNASALFRKLENMLLTRFNHFPPKTLLRLLHSCSLIESHPVNFMAKIFSPYFLQQLQGAESYLDRLSLAQLTQLFLTSILECPFYKGPKLLPKFQVKSFLTPCSSLETPMDFHLYKSVMIGLIDLLGARLYFSSKVLTPYCYTIDVEIKLDEDGFVLPFTIDEDVHKRVALCIDGPKRFCLNSKHLLGKEATKQRHLRLLGYQVVQIPYYEIEMLKSRLELVDYLQGKLFSQNSGGHW |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 591-649 | RAP | ||||
Sequence: VALCIDGPKRFCLNSKHLLGKEATKQRHLRLLGYQVVQIPYYEIEMLKSRLELVDYLQG |
Domain
RAP domain is required for FASTKD3 function in mRNA stability and translation.
Sequence similarities
Belongs to the FAST kinase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q58CX2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length660
- Mass (Da)75,487
- Last updated2007-04-17 v2
- Checksum96B35740D3EB4706
Q58CX2-2
- Name2
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 45 | in Ref. 1; AAX46672 | ||||
Sequence: F → L | ||||||
Sequence conflict | 343 | in Ref. 1; AAX46672 | ||||
Sequence: Y → F | ||||||
Alternative sequence | VSP_024622 | 453-559 | in isoform 2 | |||
Sequence: HSCSLIESHPVNFMAKIFSPYFLQQLQGAESYLDRLSLAQLTQLFLTSILECPFYKGPKLLPKFQVKSFLTPCSSLETPMDFHLYKSVMIGLIDLLGARLYFSSKVL → LLPSIFPSIKIFSSEPVLRIKWPKYWSFSISPSHEYSRWIFLEDGLVGSPCSPRDSQEPSPTPQFESINSSVLSSLYSPTVTSRHDYWKNHSFDSMDLCQQGDVFAF | ||||||
Alternative sequence | VSP_024623 | 560-660 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BT021825 EMBL· GenBank· DDBJ | AAX46672.1 EMBL· GenBank· DDBJ | mRNA | ||
DT840127 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |