Q58719 · MRE11_METJA
- ProteinDNA double-strand break repair protein Mre11
- Genemre11
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids366 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. The complex may facilitate opening of the processed DNA ends to aid in the recruitment of HerA and NurA. Mre11 binds to DSB ends and has both double-stranded 3'-5' exonuclease activity and single-stranded endonuclease activity.
Cofactor
Note: Binds 2 manganese ions per subunit.
Activity regulation
Nuclease activity is regulated by Rad50.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 8 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 10 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 49 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 49 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 84 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Active site | 85 | Proton donor | ||||
Sequence: H | ||||||
Binding site | 158 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 186 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 188 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | 3'-5' exonuclease activity | |
Molecular Function | DNA binding | |
Molecular Function | DNA end binding | |
Molecular Function | DNA exonuclease activity | |
Molecular Function | endonuclease activity | |
Molecular Function | identical protein binding | |
Molecular Function | manganese ion binding | |
Molecular Function | Y-form DNA binding | |
Biological Process | DNA repair | |
Biological Process | double-strand break repair |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA double-strand break repair protein Mre11
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageArchaea > Euryarchaeota > Methanomada group > Methanococci > Methanococcales > Methanocaldococcaceae > Methanocaldococcus
Accessions
- Primary accessionQ58719
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000138689 | 1-366 | DNA double-strand break repair protein Mre11 | |||
Sequence: MMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDNVDIESLNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFRG |
Proteomic databases
Interaction
Subunit
Homodimer. Forms a heterotetramer composed of two Mre11 subunits and two Rad50 subunits.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q58719 | mre11 Q58719 | 3 | EBI-10107692, EBI-10107692 |
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length366
- Mass (Da)43,132
- Last updated1996-11-01 v1
- ChecksumEFF6ADAD43EB5AFC
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L77117 EMBL· GenBank· DDBJ | AAB99332.1 EMBL· GenBank· DDBJ | Genomic DNA |