Q56YJ8 · FAMA_ARATH
- ProteinTranscription factor FAMA
- GeneFAMA
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids414 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription activator (PubMed:17088607, PubMed:17183265, PubMed:17183267).
Together with MYB88 and MYB124, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519).
Together with SPCH and MUTE, regulates the stomata formation. Required to promote differentiation and morphogenesis of stomatal guard cells and to halt proliferative divisions in their immediate precursors. Mediates the formation of stomata (PubMed:17088607, PubMed:17183265, PubMed:17183267).
Prevents histone H3K27me3 marks and derepresses stem cell gene expression (PubMed:24654956).
Together with MYB88 and MYB124, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519).
Together with SPCH and MUTE, regulates the stomata formation. Required to promote differentiation and morphogenesis of stomatal guard cells and to halt proliferative divisions in their immediate precursors. Mediates the formation of stomata (PubMed:17088607, PubMed:17183265, PubMed:17183267).
Prevents histone H3K27me3 marks and derepresses stem cell gene expression (PubMed:24654956).
Miscellaneous
Plants overexpressing FAMA exhibit ectopic stomata.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | protein dimerization activity | |
Biological Process | guard cell differentiation | |
Biological Process | guard cell fate commitment | |
Biological Process | guard mother cell differentiation | |
Biological Process | negative regulation of cell division | |
Biological Process | positive regulation of cell differentiation | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | response to low humidity |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTranscription factor FAMA
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ56YJ8
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Excess symmetric divisions during stomata development leading to abnormal guard cells clusters formation. Reduced seeds set and low biomass. These phenotypes are complemented by MYB124.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 251-253 | Abolishes interaction with RBR1 that leads to a stomatal lineage-specific loss of terminal commitment. | ||||
Sequence: CLE → GLK |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 20 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000358843 | 1-414 | Transcription factor FAMA | |||
Sequence: MDKDYSAPNFLGESSGGNDDNSSGMIDYMFNRNLQQQQKQSMPQQQQHQLSPSGFGATPFDKMNFSDVMQFADFGSKLALNQTRNQDDQETGIDPVYFLKFPVLNDKIEDHNQTQHLMPSHQTSQEGGECGGNIGNVFLEEKEDQDDDNDNNSVQLRFIGGEEEDRENKNVTKKEVKSKRKRARTSKTSEEVESQRMTHIAVERNRRKQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVRELEQLLQCLESQKRRRILGETGRDMTTTTTSSSSPITTVANQAQPLIITGNVTELEGGGGLREETAENKSCLADVEVKLLGFDAMIKILSRRRPGQLIKTIAALEDLHLSILHTNITTMEQTVLYSFNVKITSETRFTAEDIASSIQQIFSFIHANTNISGSSNLGNIVFT |
Proteomic databases
Expression
Tissue specificity
Resctricted to stomatal cell lineages (at protein level). Expressed in roots, leaves, stems, and flowers.
Induction
Inhibited by low relative humidity (LRH) via epigenetic CG methylation, thus leading to a reduced stomatal index.
Developmental stage
Not expressed in meristemoids, but strongly expressed in guard mother cells (GMCs) and in young guard cells (at protein level) (PubMed:17088607).
Expressed at the transition to terminal stomatal differentiation, just before and after the symmetric division of stomatal differentiation, being confined to late-stage GMC and to young, still differentiating guard cells (PubMed:24571519).
Expressed at the transition to terminal stomatal differentiation, just before and after the symmetric division of stomatal differentiation, being confined to late-stage GMC and to young, still differentiating guard cells (PubMed:24571519).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-61 | Disordered | ||||
Sequence: MDKDYSAPNFLGESSGGNDDNSSGMIDYMFNRNLQQQQKQSMPQQQQHQLSPSGFGATPFD | ||||||
Compositional bias | 11-54 | Polar residues | ||||
Sequence: LGESSGGNDDNSSGMIDYMFNRNLQQQQKQSMPQQQQHQLSPSG | ||||||
Region | 142-197 | Disordered | ||||
Sequence: KEDQDDDNDNNSVQLRFIGGEEEDRENKNVTKKEVKSKRKRARTSKTSEEVESQRM | ||||||
Compositional bias | 159-174 | Basic and acidic residues | ||||
Sequence: IGGEEEDRENKNVTKK | ||||||
Domain | 194-245 | bHLH | ||||
Sequence: SQRMTHIAVERNRRKQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVREL | ||||||
Motif | 249-253 | LxCxE motif | ||||
Sequence: LQCLE |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length414
- Mass (Da)46,408
- Last updated2005-05-10 v1
- Checksum70F6B5DC0732B1B2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1I9LN81 | A0A1I9LN81_ARATH | FMA | 402 |
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 11-54 | Polar residues | ||||
Sequence: LGESSGGNDDNSSGMIDYMFNRNLQQQQKQSMPQQQQHQLSPSG | ||||||
Compositional bias | 159-174 | Basic and acidic residues | ||||
Sequence: IGGEEEDRENKNVTKK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB028621 EMBL· GenBank· DDBJ | BAB01355.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002686 EMBL· GenBank· DDBJ | AEE76862.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK221324 EMBL· GenBank· DDBJ | BAD94119.1 EMBL· GenBank· DDBJ | mRNA | ||
BT028961 EMBL· GenBank· DDBJ | ABI54336.1 EMBL· GenBank· DDBJ | mRNA | ||
AF488624 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |