Q56EF9 · Q56EF9_9CAUD
- ProteinRNA ligase 1
- GenernlA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids383 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Involved in countering a host defense mechanism which, following viral infection, activates the host anticodon nuclease and shuts off viral translation. Repairs 5'-PO4 and 3'-OH groups in the cleaved host tRNA.
Catalytic activity
Cofactor
Note: Binds 2 magnesium ions that perform the catalytic activity via a two-metal mechanism. One of the catalytic Mg2+, which is coordinated by 5 water molecules, engages the lysine nucleophile and the ATP alpha phosphate while the Mg2+ orients the PPi leaving group.
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 41 | ATP (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 58 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 80 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Active site | 104 | N6-AMP-lysine intermediate | ||||
Sequence: K | ||||||
Binding site | 163 | ATP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Site | 163 | Essential for RNA ligase activity | ||||
Sequence: E | ||||||
Binding site | 250 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 252 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Site | 256 | Essential for RNA ligase activity | ||||
Sequence: Y | ||||||
Binding site | 282 | Mg2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: D |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | ATP binding | |
Molecular Function | metal ion binding | |
Molecular Function | RNA ligase (ATP) activity | |
Biological Process | RNA repair |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRNA ligase 1
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Straboviridae > Biquartavirus > Biquartavirus 44RR2
Accessions
- Primary accessionQ56EF9
Proteomes
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 56-242 | T4 RNA ligase 1-like N-terminal | ||||
Sequence: ESRGIMFEITEEGKPVRIMARPMQKFFNLKENPFTMNLDLTKMVGLMEKADGSLISSYHDQGYIFLKSKAAIHSDQANKAMALLNSPAYEKLRERIADSGPGYTFNMEYVGPSNRIVLPYEDEELIVLNVRHNETGEYVNISTLMNDPATRSRMVGVYPSPDWEKITPAEWEAGVRAETDIEGVIGI | ||||||
Domain | 263-382 | T4 RNA ligase 1 C-terminal | ||||
Sequence: KDSINNNKALIQSIKERATDDLRGLFADDVVSIAKIEDFEELYISTISRYHELCFSVYQSLRGKDRRSFAIEAQAKLSDHRYLFSIVMRQYARDWDSEEVIGAIEEHMVKNYDKYTPAKY |
Sequence similarities
Belongs to the Tequatrovirus RNA ligase 1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length383
- Mass (Da)43,980
- Last updated2005-05-10 v1
- Checksum893F9E887BC75751
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY962392 EMBL· GenBank· DDBJ | AAX63691.1 EMBL· GenBank· DDBJ | Genomic DNA |