Q53R41 · FAKD1_HUMAN
- ProteinFAST kinase domain-containing protein 1, mitochondrial
- GeneFASTKD1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids847 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the down-regulation of mitochondrial MT-ND3 mRNA levels which leads to decreased respiratory complex I abundance and activity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial matrix | |
Cellular Component | mitochondrion | |
Cellular Component | ribonucleoprotein granule | |
Molecular Function | RNA binding | |
Biological Process | mitochondrial RNA metabolic process | |
Biological Process | mitochondrial RNA processing | |
Biological Process | regulation of mitochondrial mRNA stability |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFAST kinase domain-containing protein 1, mitochondrial
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ53R41
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Preferentially localizes to mitochondrial RNA granules, platforms for post-transcriptional RNA modification and ribosome assembly (PubMed:28335001).
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_031806 | 384 | in dbSNP:rs12618227 | |||
Sequence: E → Q | ||||||
Natural variant | VAR_031807 | 446 | in dbSNP:rs35106223 | |||
Sequence: C → G | ||||||
Natural variant | VAR_031808 | 467 | in dbSNP:rs2253680 | |||
Sequence: M → V |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 905 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, transit peptide, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000284710 | ?-847 | FAST kinase domain-containing protein 1, mitochondrial | |||
Sequence: MKKTPVFLESLVTNMLRLRAICPFSWRVFQFRPISCEPLIIQMNKCTDEEQMFGFIERNKAILSEKQVGCAFDMLWKLQKQKTSLLKNAEYVRDHPQFLTLHNLATNKFKLMNDDTLVNVLYVTQQFAGEAHDPLVEALVTEAWRRLERFDIKLLSEFSSCLADQHLYFSPLMGKIADIVHRNLETTQDLSSLSVLMVNISSLISRHFQQQLVNKTELLFDTIDSSEVNVAKSIAKFLRNVRYRYQPLLERCNNVFLSNVDHLDLDSISKILSVYKFLQFNSFEFIIMAKKKLTEMIPLCNHPASFVKLFVALGPIAGPEEKKQLKSTMLLMSEDLTGEQALAVLGAMGDMESRNSCLIKRVTSVLHKHLDGYKPLELLKITQELTFLHFQRKEFFAKLRELLLSYLKNSFIPTEVSVLVRAISLLPSPHLDEVGISRIEAVLPQCDLNNLSSFATSVLRWIQHDHMYLDNMTAKQLKLLQKLDHYGRQRLQHSNSLDLLRKELKSLKGNTFPESLLEEMIATLQHFMDDINYINVGEIASFISSTDYLSTLLLDRIASVAVQQIEKIHPFTIPAIIRPFSVLNYDPPQRDEFLGTCVQHLNSYLGILDPFILVFLGFSLATLEYFPEDLLKAIFNIKFLARLDSQLEILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKGIGGMDGTQQQIFKMLAEVLGGINCVKASVLTPYYHKVDFECILDKRKKPLPYGSHNIALGQLPEMPWESNIEIVGSRLPPGAERIALEFLDSKALCRNIPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDARMDYLRECIFGEVKSCL | ||||||
Transit peptide | 1-? | Mitochondrion | ||||
Modified residue | 360 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expression detected in spleen, thymus, testis, ovary, colon, heart, smooth muscle, kidney, brain, lung, liver and white adipose tissue with highest expression in heart.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q53R41 | EIF2S3 P41091 | 3 | EBI-3957005, EBI-1054228 | |
BINARY | Q53R41 | GFAP P14136 | 3 | EBI-3957005, EBI-744302 | |
BINARY | Q53R41 | GRN P28799 | 3 | EBI-3957005, EBI-747754 | |
BINARY | Q53R41 | HSPA2 P54652 | 3 | EBI-3957005, EBI-356991 | |
BINARY | Q53R41 | HTT P42858 | 9 | EBI-3957005, EBI-466029 | |
BINARY | Q53R41 | JPH3 Q8WXH2 | 3 | EBI-3957005, EBI-1055254 | |
BINARY | Q53R41 | KIF1B O60333-2 | 3 | EBI-3957005, EBI-10975473 | |
BINARY | Q53R41 | NEFL P07196 | 3 | EBI-3957005, EBI-475646 | |
BINARY | Q53R41 | P4HB P07237 | 3 | EBI-3957005, EBI-395883 | |
BINARY | Q53R41 | ST13 Q9P1I4 | 3 | EBI-3957005, EBI-25892254 | |
BINARY | Q53R41 | WFS1 O76024 | 3 | EBI-3957005, EBI-720609 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 777-837 | RAP | ||||
Sequence: IALEFLDSKALCRNIPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDARMDYLRE |
Domain
The RAP domain is essential to regulate MT-ND3 mRNA levels.
Sequence similarities
Belongs to the FAST kinase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q53R41-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length847
- Mass (Da)97,411
- Last updated2005-05-24 v1
- Checksum5026A635048EB0B3
Q53R41-2
- Name2
- Differences from canonical
- 649-692: ILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKG → S
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 213 | in Ref. 1; BAB85043 | ||||
Sequence: V → M | ||||||
Sequence conflict | 228 | in Ref. 1; BAB85043 | ||||
Sequence: V → A | ||||||
Sequence conflict | 288 | in Ref. 1; BAB15168 | ||||
Sequence: M → T | ||||||
Sequence conflict | 293 | in Ref. 1; BAB85043 | ||||
Sequence: L → P | ||||||
Alternative sequence | VSP_024617 | 649-692 | in isoform 2 | |||
Sequence: ILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKG → S | ||||||
Sequence conflict | 756 | in Ref. 4; BAB47429 | ||||
Sequence: E → EMPWESNIEIVGSRLPPGAERIALEFLDSKA |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK025554 EMBL· GenBank· DDBJ | BAB15168.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK055892 EMBL· GenBank· DDBJ | BAB71037.1 EMBL· GenBank· DDBJ | mRNA | ||
AK074302 EMBL· GenBank· DDBJ | BAB85043.1 EMBL· GenBank· DDBJ | mRNA | ||
AC093899 EMBL· GenBank· DDBJ | AAY24118.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC032687 EMBL· GenBank· DDBJ | AAH32687.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AB058703 EMBL· GenBank· DDBJ | BAB47429.1 EMBL· GenBank· DDBJ | mRNA |