Q53NI2 · NADK2_ORYSJ
- ProteinProbable NAD kinase 2, chloroplastic
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids981 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Involved in chlorophyll synthesis and chloroplast protection against oxidative damage.
Catalytic activity
- ATP + NAD+ = ADP + H+ + NADP+
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Molecular Function | ATP binding | |
Molecular Function | calmodulin binding | |
Molecular Function | NAD+ kinase activity | |
Biological Process | NAD metabolic process | |
Biological Process | NADP biosynthetic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProbable NAD kinase 2, chloroplastic
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ53NI2
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, transit peptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000233706 | ?-981 | Probable NAD kinase 2, chloroplastic | |||
Sequence: MLAVCARHGPAKLPPPPPPLAGERAAAWVVGRWWWRPAAAGRRGVVAARASFFSSRIGLDSQNYHTRDLSQLLWVGPVPGDIAEIEAYCRIFRAAEQLHTAVMSALCDPETGECPVRYDVQTEDLPVLEDKVAAVLGCMLALLNRGRKEVLSGRSGVASAFQGSEDSTMDKIPPLALFRGDLKRCCESMQVALASYLVPSEARGLDIWRKLQRLKNACYDAGFPRADGHPCPTLFANWFPVYFSTVPDDSLSDELEVAFWRGGQVSEEGLEWLLLKGFKTIVDLREEDVKDDLYLSAIHEAVSLGKIEVVNLPVEIGTAPSAEQVQRFAEIVSDSAKKPIYLHSQEGISRTSAMVSRWKQYVTRAERLATQNRSLNGNGKHVRNDQTEQLTNSPGFSSEGSENGTPLESDRTMEGETCDIDIETARHNLEITNSLPSEQSTEQGELHGTRTELQSNFRLESNPLKAQFPSCDVFSKKGMTDFFRSKKVYPKSVLNPRRRSNSLLVSRRKQSLSAEQNGAIDYEAAEFKVLKSSNGASFDNDYILSVASGITNGKPSNNGASTSVEDREMETSVVTVDPRTSDTSNSNGNAPLGSQKSAERNGSLYVEREKSDHVDGNMCASATGVVRLQSRRKAEMFLVRTDGFSCTREKVTESSLAFTHPSTQQQMLMWKSPPKTVLLLKKLGDELMEEAKEVASFLHHQEKMNVLVEPDVHDIFARIPGYGFVQTFYTQDTSDLHERVDFVACLGGDGVILHASNLFRTSVPPVVSFNLGSLGFLTSHNFEGFRQDLRAVIHGNNTLGVYITLRMRLRCEIFRNGKAMPGKVFDVLNEVVVDRGSNPYLSKIECYEHNHLITKVQGDGVIVATPTGSTAYSTAAGGSMVHPNVPCMLFTPICPHSLSFRPVILPDSARLELKIPDDARSNAWVSFDGKRRQQLSRGDSVQISMSQHPLPTVNKSDQTGDWFRSLIRCLNWNERLDQKAL | ||||||
Transit peptide | 1-? | Chloroplast |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 319-364 | Calmodulin-binding | ||||
Sequence: APSAEQVQRFAEIVSDSAKKPIYLHSQEGISRTSAMVSRWKQYVTR | ||||||
Compositional bias | 369-410 | Polar residues | ||||
Sequence: ATQNRSLNGNGKHVRNDQTEQLTNSPGFSSEGSENGTPLESD | ||||||
Region | 369-413 | Disordered | ||||
Sequence: ATQNRSLNGNGKHVRNDQTEQLTNSPGFSSEGSENGTPLESDRTM | ||||||
Region | 551-601 | Disordered | ||||
Sequence: TNGKPSNNGASTSVEDREMETSVVTVDPRTSDTSNSNGNAPLGSQKSAERN |
Sequence similarities
Belongs to the NAD kinase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length981
- Mass (Da)108,613
- Last updated2005-05-24 v1
- Checksum18DECA59F458B6B6
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0N7KSJ8 | A0A0N7KSJ8_ORYSJ | Os11g0191400 | 796 | ||
A0A0P0XZP4 | A0A0P0XZP4_ORYSJ | Os11g0191400 | 369 |
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 369-410 | Polar residues | ||||
Sequence: ATQNRSLNGNGKHVRNDQTEQLTNSPGFSSEGSENGTPLESD | ||||||
Sequence conflict | 610 | in Ref. 5; AK065215 | ||||
Sequence: K → R | ||||||
Sequence conflict | 809 | in Ref. 5; AK065215 | ||||
Sequence: L → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC134046 EMBL· GenBank· DDBJ | AAX95220.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DP000010 EMBL· GenBank· DDBJ | ABA91849.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008217 EMBL· GenBank· DDBJ | BAF27778.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014967 EMBL· GenBank· DDBJ | BAT13017.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK065215 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |