Q52JJ6 · Q52JJ6_MOUSE
- ProteinAminopeptidase
- GeneEnpep
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids945 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Regulates central hypertension through its calcium-modulated preference to cleave N-terminal acidic residues from peptides such as angiotensin II.
Catalytic activity
Cofactor
Note: Binds 1 zinc ion per subunit.
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 215 | substrate | ||||
Sequence: E | ||||||
Binding site | 349-353 | substrate | ||||
Sequence: GAMEN | ||||||
Binding site | 385 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Active site | 386 | Proton acceptor | ||||
Sequence: E | ||||||
Binding site | 389 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Binding site | 408 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: E | ||||||
Site | 471 | Transition state stabilizer | ||||
Sequence: Y | ||||||
Binding site | 878 | substrate | ||||
Sequence: R |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | metalloaminopeptidase activity | |
Molecular Function | zinc ion binding | |
Biological Process | cell migration | |
Biological Process | cell population proliferation | |
Biological Process | proteolysis | |
Biological Process | regulation of systemic arterial blood pressure by renin-angiotensin |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameAminopeptidase
- EC number
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ52JJ6
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type II membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 19-39 | Helical | ||||
Sequence: VAIICGVVVAVGLIVGLSVGL |
Keywords
- Cellular component
PTM/Processing
PTM databases
Expression
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 43-77 | Disordered | ||||
Sequence: CEQDTTPAPSQPPPEASTALPPQDQNVCPDSEDES | ||||||
Domain | 91-278 | Aminopeptidase N-like N-terminal | ||||
Sequence: PVHYDLEVKALMEEDRYTGIVTISVNLSKPTRDLWLHIRETKITKLPELRRPSGEQVPIRRCFEYKKQEYVVIQAAEDLAATSGDSVYRLTMEFKGWLNGSLVGFYKTTYMEDGQIRSIAATDHEPTDARKSFPCFDEPNKKSTYSISIIHPKEYSALSNMPEEKSEMVDDNWKKTTFVKSVPMSTYL | ||||||
Domain | 313-530 | Peptidase M1 membrane alanine aminopeptidase | ||||
Sequence: YAANITQAVFDYFEDYFAMEYALPKLDKIAIPDFGTGAMENWGLVTYRETNLLYDPLLSASSNQQRVASVVAHELVHQWFGNTVTMDWWDDLWLNEGFASFFEFLGVNHAEKDWQMLSQVLLEDVFPVQEDDSLMSSHPVVVTVSTPAEITSVFDGISYSKGASILRMLQDWITPEKFQKGCQIYLKKFQFANAKTSDFWDSLQEASNLPVKEVMDTW | ||||||
Domain | 607-924 | ERAP1-like C-terminal | ||||
Sequence: FLKINPDHIGFYRVNYEGGTWDWIAEALSSNHTRFSAADRSSFIDDAFALARAQLLNYKIALNLTMYLKSEEDFLPWERVISSVSYIISMFEDDRELYPMIETYFQGQVKPVADLLGWQDTGSHITKLLRASILGFACKMGDREALGNASQLFDSWLKGSASIPVNLRLLVYRYGMQNSGNEAAWNYTLEQYQKTSLAQEKEKLLYGLASVKDVKLLARYLEMLKDPNIIKTQDVFTVIRYISYNSYGKTMAWNWIQLNWDYLVSRFTINDRYLGRIVTIAEPFNTELQLWQMQSFFAKYPNAGAGAKPREQVLETVK |
Sequence similarities
Belongs to the peptidase M1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length945
- Mass (Da)107,956
- Last updated2005-05-24 v1
- ChecksumA93A00CB8635F574
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC127060 EMBL· GenBank· DDBJ | AAI27061.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ000292 EMBL· GenBank· DDBJ | AAY16106.1 EMBL· GenBank· DDBJ | mRNA | ||
AK146808 EMBL· GenBank· DDBJ | BAE27448.1 EMBL· GenBank· DDBJ | mRNA |