Q501J7 · PHAR4_MOUSE
- ProteinPhosphatase and actin regulator 4
- GenePhactr4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids694 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulator of protein phosphatase 1 (PP1) required for neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development. Acts as an activator of PP1 by interacting with PPP1CA and preventing phosphorylation of PPP1CA at 'Thr-320'. During neural tube closure, localizes to the ventral neural tube and activates PP1, leading to down-regulate cell proliferation within cranial neural tissue and the neural retina. Also acts as a regulator of migration of enteric neural crest cells (ENCCs) by activating PP1, leading to dephosphorylation and subsequent activation of cofilin (COF1 or COF2) and repression of the integrin signaling through the RHO/ROCK pathway.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | lamellipodium | |
Molecular Function | actin binding | |
Molecular Function | protein phosphatase 1 binding | |
Molecular Function | protein phosphatase activator activity | |
Molecular Function | protein phosphatase inhibitor activity | |
Biological Process | actin cytoskeleton organization | |
Biological Process | closure of optic fissure | |
Biological Process | enteric nervous system development | |
Biological Process | negative regulation of integrin-mediated signaling pathway | |
Biological Process | neural crest cell migration | |
Biological Process | neural tube closure | |
Biological Process | positive regulation of catalytic activity | |
Biological Process | regulation of cell cycle | |
Biological Process | Rho protein signal transduction |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended namePhosphatase and actin regulator 4
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ501J7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Neural tube and eye defects in embryos followed by death. By 9.25 dpc, mutant embryos show failure to close the cranial neural tube. About 15% of homozygous mutant embryos exhibit severe exencephaly, along with a wavy spinal neural tube and a shortened anterior/posterior body axis, and die around 10.5 dpc. Remaining embryos exhibit complete exencephaly from the forebrain to hindbrain. Most embryos die by 14.5 dpc, but a few survive to birth and die shortly thereafter. Embryos also have eye defects: they display overgrowth of the neural retina and retinal pigment epithelium. Embryos also display coloboma at 12.5 dpc and 16.5 dpc, due to defects in closure of optic fissure. Defects are due to elevated proliferation and abnormally phosphorylated, inactive PP1, resulting in RB1 hyperphosphorylation, derepression of E2F targets, and abnormal cell-cycle progression. Embryos also show embryonic gastrointestinal defects due to colon hypoganglionosis, which resembles human Hirschsprung disease: ENCCs within the embryonic gut display a collective cell migration defect and show undirected cellular protrusions and disrupted directional and chain migration.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 650 | In humdy; failure to close the neural tube and optic fissure, causing exencephaly and retinal coloboma and common birth defects. Specifically disrupts interaction with PPP1CA while it does not affect interaction with actin. | ||||
Sequence: R → P |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 45 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000287307 | 1-694 | Phosphatase and actin regulator 4 | |||
Sequence: MEDPSEEAEQPSGDPGMGMDSVEAGDTTPPTKRKSKFSALGKIFKPWKWRKKKSSDKFKETSEVLERKISMRKPREELVKRGVLLEDPEQDGEDSGKLSHAALKNGHTTPIGSARSSSPVLVEEEPERSLRNLTPEEESKKRLGSTGSQPNSEAEPGPEHAPKQPLLPPKRPLSSSCEAKEVPAGSTARSVSSTSGSTTVTSAATTAATDMTKTVKSFVGPTPAPAPAPRTLPAAPASANTAATTTAPAKQPPIPPPKPAQRNSNPIIAELSQAMNSGTVLSKPSPPLPPKRGIPSTSIPSLEPAASFTTKTANDQREKTVSLCLEPPLIIPPSSPSPPLPTHIPPEPPRSPLVPAKTFQIVPEVEFSSSSDLFQDISQQEDQKTEVPKKIQDQSFGESHIPSRLPPLPLHIRIQQALTSPLPVTPPLEGTHRAHSLLFENSDSFSEDTGTLGRTRSLPITIEMLKVPDDEEEEQTCPFVEDVTSTSATPSLPLCLREEEKESDSDSEGPIKYRDEEEDDDDDESHQSALANRVKRKDTLAMKLSSRPSEPETNLNSWPRKSKEEWNEIRHQIGNTLIRRLSQRPTAEELEQRNILQPKNEADRQAEKREIKRRLTRKLSQRPTVAELLARKILRFNEYVEVTDAHDYDRRADKPWTKLTPADKAAIRKELNEFKSSEMEVHVDSKHFTRYHRP | ||||||
Modified residue | 116 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 118 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 129 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 145 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 264 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 285 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 335 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 337 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 420 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 425 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 436 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 446 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 457 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 503 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 505 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 549 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 582 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 620 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Developmental stage
During embryonic development, most strongly expressed in neural tissue. Expressed in a dynamic pattern during neurulation: from 8.5 dpc to 9.5 dpc, the period of cranial neural closure and spatially regulated proliferation, it is expressed strongly in the ventral region of the cranial neural tube. By 10.5 dpc, expressed more uniformly along the dorsal and ventral aspects of the cranial neural tube. Also expressed in the neural retina and lens.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-354 | Disordered | ||||
Sequence: MEDPSEEAEQPSGDPGMGMDSVEAGDTTPPTKRKSKFSALGKIFKPWKWRKKKSSDKFKETSEVLERKISMRKPREELVKRGVLLEDPEQDGEDSGKLSHAALKNGHTTPIGSARSSSPVLVEEEPERSLRNLTPEEESKKRLGSTGSQPNSEAEPGPEHAPKQPLLPPKRPLSSSCEAKEVPAGSTARSVSSTSGSTTVTSAATTAATDMTKTVKSFVGPTPAPAPAPRTLPAAPASANTAATTTAPAKQPPIPPPKPAQRNSNPIIAELSQAMNSGTVLSKPSPPLPPKRGIPSTSIPSLEPAASFTTKTANDQREKTVSLCLEPPLIIPPSSPSPPLPTHIPPEPPRSPLV | ||||||
Compositional bias | 53-100 | Basic and acidic residues | ||||
Sequence: KSSDKFKETSEVLERKISMRKPREELVKRGVLLEDPEQDGEDSGKLSH | ||||||
Repeat | 63-88 | RPEL 1 | ||||
Sequence: EVLERKISMRKPREELVKRGVLLEDP | ||||||
Compositional bias | 121-143 | Basic and acidic residues | ||||
Sequence: LVEEEPERSLRNLTPEEESKKRL | ||||||
Compositional bias | 186-216 | Polar residues | ||||
Sequence: STARSVSSTSGSTTVTSAATTAATDMTKTVK | ||||||
Compositional bias | 265-282 | Polar residues | ||||
Sequence: NPIIAELSQAMNSGTVLS | ||||||
Compositional bias | 300-319 | Polar residues | ||||
Sequence: PSLEPAASFTTKTANDQREK | ||||||
Compositional bias | 329-353 | Pro residues | ||||
Sequence: LIIPPSSPSPPLPTHIPPEPPRSPL | ||||||
Region | 375-405 | Disordered | ||||
Sequence: QDISQQEDQKTEVPKKIQDQSFGESHIPSRL | ||||||
Region | 467-562 | Disordered | ||||
Sequence: VPDDEEEEQTCPFVEDVTSTSATPSLPLCLREEEKESDSDSEGPIKYRDEEEDDDDDESHQSALANRVKRKDTLAMKLSSRPSEPETNLNSWPRKS | ||||||
Compositional bias | 495-512 | Basic and acidic residues | ||||
Sequence: CLREEEKESDSDSEGPIK | ||||||
Compositional bias | 526-543 | Basic and acidic residues | ||||
Sequence: HQSALANRVKRKDTLAMK | ||||||
Repeat | 575-600 | RPEL 2 | ||||
Sequence: NTLIRRLSQRPTAEELEQRNILQPKN | ||||||
Region | 589-608 | Disordered | ||||
Sequence: ELEQRNILQPKNEADRQAEK | ||||||
Compositional bias | 594-608 | Basic and acidic residues | ||||
Sequence: NILQPKNEADRQAEK | ||||||
Repeat | 613-638 | RPEL 3 | ||||
Sequence: RRLTRKLSQRPTVAELLARKILRFNE |
Sequence similarities
Belongs to the phosphatase and actin regulator family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q501J7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length694
- Mass (Da)76,632
- Last updated2007-05-15 v2
- Checksum3AEB17E6A390DD29
Q501J7-2
- Name2
- Differences from canonical
- 64-90: Missing
Q501J7-3
- Name3
- Differences from canonical
- 1-5: MEDPS → MGQADVSRPVNPDAV
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0A0MQJ4 | A0A0A0MQJ4_MOUSE | Phactr4 | 298 | ||
A0A0A0MQL5 | A0A0A0MQL5_MOUSE | Phactr4 | 157 |
Sequence caution
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_025439 | 1-5 | in isoform 3 | |||
Sequence: MEDPS → MGQADVSRPVNPDAV | ||||||
Compositional bias | 53-100 | Basic and acidic residues | ||||
Sequence: KSSDKFKETSEVLERKISMRKPREELVKRGVLLEDPEQDGEDSGKLSH | ||||||
Alternative sequence | VSP_025440 | 64-90 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 121-143 | Basic and acidic residues | ||||
Sequence: LVEEEPERSLRNLTPEEESKKRL | ||||||
Compositional bias | 186-216 | Polar residues | ||||
Sequence: STARSVSSTSGSTTVTSAATTAATDMTKTVK | ||||||
Sequence conflict | 212 | in Ref. 1; BAC33611 | ||||
Sequence: T → K | ||||||
Sequence conflict | 224 | in Ref. 3; AAH96033 | ||||
Sequence: A → S | ||||||
Compositional bias | 265-282 | Polar residues | ||||
Sequence: NPIIAELSQAMNSGTVLS | ||||||
Compositional bias | 300-319 | Polar residues | ||||
Sequence: PSLEPAASFTTKTANDQREK | ||||||
Compositional bias | 329-353 | Pro residues | ||||
Sequence: LIIPPSSPSPPLPTHIPPEPPRSPL | ||||||
Compositional bias | 495-512 | Basic and acidic residues | ||||
Sequence: CLREEEKESDSDSEGPIK | ||||||
Compositional bias | 526-543 | Basic and acidic residues | ||||
Sequence: HQSALANRVKRKDTLAMK | ||||||
Compositional bias | 594-608 | Basic and acidic residues | ||||
Sequence: NILQPKNEADRQAEK |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK049209 EMBL· GenBank· DDBJ | BAC33611.1 EMBL· GenBank· DDBJ | mRNA | ||
AK220496 EMBL· GenBank· DDBJ | BAD90294.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AL805897 EMBL· GenBank· DDBJ | CAM26521.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL805897 EMBL· GenBank· DDBJ | CAM26523.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL805897 EMBL· GenBank· DDBJ | CAM26520.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
BC075672 EMBL· GenBank· DDBJ | AAH75672.1 EMBL· GenBank· DDBJ | mRNA | ||
BC096033 EMBL· GenBank· DDBJ | AAH96033.1 EMBL· GenBank· DDBJ | mRNA |