Q4V9J0 · QTGAL_DANRE
- ProteinQueuosine-tRNA galactosyltransferase
- Geneb3gntl1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids338 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Glycosyltransferase that specifically catalyzes galactosylation of cytoplasmic tRNA(Tyr) modified with queuosine at position 34 (queuosine34).
Galactosylates the cyclopentene hydroxyl group of queuosine34 in tRNA(Tyr) to form galactosyl-queuosine34. Mannosylation of queuosine34 in tRNA(Tyr) is required to slow-down elongation at cognate codons UAC and suppress stop codon readthrough, thereby regulating protein translation.
Galactosylates the cyclopentene hydroxyl group of queuosine34 in tRNA(Tyr) to form galactosyl-queuosine34. Mannosylation of queuosine34 in tRNA(Tyr) is required to slow-down elongation at cognate codons UAC and suppress stop codon readthrough, thereby regulating protein translation.
Catalytic activity
- queuosine34 in tRNA(Tyr) + UDP-alpha-D-galactose = H+ + O-5''-beta-D-galactosylqueuosine34 in tRNA(Tyr) + UDPThis reaction proceeds in the forward direction.
RHEA-COMP:19044 CHEBI:194431 Position: 34+ CHEBI:66914 = CHEBI:15378 + RHEA-COMP:19043 + CHEBI:58223
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | tRNA-queuosine(34) galactosyltransferase activity | |
Biological Process | regulation of translation | |
Biological Process | tRNA modification |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameQueuosine-tRNA galactosyltransferase
- EC number
- Short namesQTGAL
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ4V9J0
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Decreased postembryonic growth, characterized by shortened body length.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000459840 | 1-338 | Queuosine-tRNA galactosyltransferase | |||
Sequence: MPVFNASDWLDECLQAILEQDFQGRMELCVFDDGSTDGSRELVERWRPKFEDRGISVLISGHKSSSPRGVGYAKNQAVSQSSGRFLCFQDADDVMKPQRVRLQQEAAAANPTAIVGCKVCRVPEGSTGRYTRWINSLSAEQLLTQVYTSHGPTVIMPSWFCSRSWFEKVGQFHEGGKGVPEDLLFFYQSLRLGGLVLRVDECLLVYRYHEHAATHSVLEQTIWDLRVDFLQERVLSQWDSFTIWNAGKQGRKLYRSLRPDNQSKVKAFCDVDENKIKKGFYTYEESKERPKPKIPVLHFRNASPPFIVCVKLDMTDGVLEGNLHSLQLTEGVHYYHFN |
Structure
Sequence
- Sequence statusComplete
- Length338
- Mass (Da)38,682
- Last updated2005-07-05 v1
- ChecksumFABB4A56EA5993C5
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX908759 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC096875 EMBL· GenBank· DDBJ | AAH96875.1 EMBL· GenBank· DDBJ | mRNA |