Q4V920 · PACN1_DANRE
- ProteinProtein kinase C and casein kinase substrate in neurons protein 1
- Genepacsin1b
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids445 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds to membranes via its F-BAR domain and mediates membrane tubulation. Plays a role in cellular transport processes by recruiting dynamins to membranes. Plays a role in the reorganization of the actin cytoskeleton and in neuron morphogenesis via its interaction with cobl, and by recruiting cobl to the cell cortex. Plays a role in the regulation of neurite formation, neurite branching and the regulation of neurite length. Required for normal synaptic vesicle endocytosis; this process retrieves previously released neurotransmitters to accommodate multiple cycles of neurotransmission. Required for normal excitatory and inhibitory synaptic transmission (By similarity).
Required for normal embryonic development, including normal development of laterality, normal body size and shape, as well as normal brain and heart development. Required for normal development of stereocilia and kinocilia in sensory hair cells of neuromasts in the posterior lateral line organ, and thus also for balance keeping and normal swimming behavior
Required for normal embryonic development, including normal development of laterality, normal body size and shape, as well as normal brain and heart development. Required for normal development of stereocilia and kinocilia in sensory hair cells of neuromasts in the posterior lateral line organ, and thus also for balance keeping and normal swimming behavior
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic vesicle membrane | |
Cellular Component | cytosol | |
Cellular Component | endosome | |
Cellular Component | neuron projection | |
Cellular Component | plasma membrane | |
Cellular Component | ruffle membrane | |
Cellular Component | synapse | |
Molecular Function | phospholipid binding | |
Biological Process | actin filament organization | |
Biological Process | auditory receptor cell stereocilium organization | |
Biological Process | cilium assembly | |
Biological Process | cytoskeleton organization | |
Biological Process | endocytosis | |
Biological Process | neuron projection morphogenesis | |
Biological Process | plasma membrane tubulation | |
Biological Process | positive regulation of dendrite development | |
Biological Process | regulation of endocytosis |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameProtein kinase C and casein kinase substrate in neurons protein 1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ4V920
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Cytoplasmic vesicle membrane ; Peripheral membrane protein
Membrane ; Peripheral membrane protein
Note: Detected in axons. In primary neuronal cultures, present at a high level in presynaptic nerve terminals and in the cell body. Detected at vesicular structures in neuron cell bodies and neurites (By similarity).
Detected at the apical surface of cells at the basis of forming cilia, but not in the cilia themselves
Detected at the apical surface of cells at the basis of forming cilia, but not in the cilia themselves
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000422220 | 1-445 | Protein kinase C and casein kinase substrate in neurons protein 1 | |||
Sequence: MSGAYDESAMSDETTDSFWEVGNYKRTVKRIEDGHRLCNDMMSCIQERAKIEKAYSQQLTDWSKRWRQLVERGPQYGTLERAWLAVMTEAEKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQMMGGFKETKEADEGFRKAQKPWAKKLKELETAKKTYHMACKEEKIASAREANSKGEASVTTDQQKKLQEKVDKCKNDVQKAKEKYEKSLDELNKCTPQYMENMEVVFDQCQQFEEKRLNFLREVLLDTKRHLNLTESQSYATVYRELERTIVSASAQEDLKWFSSVHGPGMHMNWPQFEEFNPDLSHAISKKEKVKRNHDGVTLTQVTHGAEHGTPQTGDRGSVSSYEKNQQYSAEWSDDEQPPTAAQSASETNGGNPFEEDSKGVRVRALYDYEGQEQDELTFKAGDELTKLEDEDEQGWCKGRLDSGQLGLYPANYVEPV |
Proteomic databases
Expression
Developmental stage
Highly expressed throughout embryogenesis, from fertilization to hatching. Detected in embryonic neuronal tissues, including forebrain, hindbrain, spinal cord and retina.
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for domain, coiled coil, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 12-282 | F-BAR | ||||
Sequence: DETTDSFWEVGNYKRTVKRIEDGHRLCNDMMSCIQERAKIEKAYSQQLTDWSKRWRQLVERGPQYGTLERAWLAVMTEAEKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQMMGGFKETKEADEGFRKAQKPWAKKLKELETAKKTYHMACKEEKIASAREANSKGEASVTTDQQKKLQEKVDKCKNDVQKAKEKYEKSLDELNKCTPQYMENMEVVFDQCQQFEEKRLNFLREVLLDTKRHLNLTESQSYATVYRELERTIVSASAQED | ||||||
Coiled coil | 146-167 | |||||
Sequence: AKKLKELETAKKTYHMACKEEK | ||||||
Coiled coil | 183-219 | |||||
Sequence: TTDQQKKLQEKVDKCKNDVQKAKEKYEKSLDELNKCT | ||||||
Compositional bias | 327-381 | Polar residues | ||||
Sequence: LTQVTHGAEHGTPQTGDRGSVSSYEKNQQYSAEWSDDEQPPTAAQSASETNGGNP | ||||||
Region | 327-390 | Disordered | ||||
Sequence: LTQVTHGAEHGTPQTGDRGSVSSYEKNQQYSAEWSDDEQPPTAAQSASETNGGNPFEEDSKGVR | ||||||
Domain | 386-445 | SH3 | ||||
Sequence: SKGVRVRALYDYEGQEQDELTFKAGDELTKLEDEDEQGWCKGRLDSGQLGLYPANYVEPV |
Domain
The F-BAR domain mediates membrane-binding and membrane tubulation.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length445
- Mass (Da)51,356
- Last updated2005-07-05 v1
- Checksum53552263222290C5
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 327-381 | Polar residues | ||||
Sequence: LTQVTHGAEHGTPQTGDRGSVSSYEKNQQYSAEWSDDEQPPTAAQSASETNGGNP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CU694224 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CU855791 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CU855800 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CU914470 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC097107 EMBL· GenBank· DDBJ | AAH97107.1 EMBL· GenBank· DDBJ | mRNA |