Q4V5R4 · POLYP_DROME
- ProteinGlutamate transporter polyphemus
- Genepolyph
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids460 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Probable glutamate transporter which transports extracellular glutamate into the cells. Regulates the production of intracellular reactive oxygen species (ROS) probably by controlling the synthesis of antioxidant glutathione. By regulating ROS production in blood cells, required for maintaining bacteria phagocytosis following infection with S.aureus and possibly E.coli.
Miscellaneous
The name 'polyphemus' derives from the Cyclops in Greek mythology that failed to guard against Odysseus as mutants are unable to defend against microbial infection.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | plasma membrane | |
Cellular Component | vacuolar membrane | |
Molecular Function | amino acid transmembrane transporter activity | |
Molecular Function | L-amino acid transmembrane transporter activity | |
Biological Process | amino acid transmembrane transport | |
Biological Process | defense response to bacterium | |
Biological Process | phagocytosis | |
Biological Process | sexual reproduction |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlutamate transporter polyphemus
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ4V5R4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 51-71 | Helical | ||||
Sequence: AFISLLKCVIGTGILAMPLAF | ||||||
Transmembrane | 78-98 | Helical | ||||
Sequence: MGTVMSILLMILLTYSIHLLI | ||||||
Transmembrane | 139-159 | Helical | ||||
Sequence: FMTTCVLVFGQFLLCTVYLVF | ||||||
Transmembrane | 181-201 | Helical | ||||
Sequence: VLVACLLLLPLFMIRRLKYLV | ||||||
Transmembrane | 203-223 | Helical | ||||
Sequence: LNLISNFLLYAGFALIMYYLF | ||||||
Transmembrane | 241-261 | Helical | ||||
Sequence: WIEFIAIAAFSLTAVGSMLVV | ||||||
Transmembrane | 275-295 | Helical | ||||
Sequence: FGVLNLAVLFILLSNMFFGII | ||||||
Transmembrane | 324-344 | Helical | ||||
Sequence: VFIASGIFLSYPLNGFVVITV | ||||||
Transmembrane | 368-388 | Helical | ||||
Sequence: LLFLFLTGAVAIGVPNLAALT | ||||||
Transmembrane | 390-410 | Helical | ||||
Sequence: LEGAFSLSNLNLLCPALIDVF | ||||||
Transmembrane | 428-448 | Helical | ||||
Sequence: ILLILIGLIFGIVGCTVALMQ |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown in adult blood cells results in decreased survival following infection with S.aureus. Adults infected with S.aureus display decreased phagocytosis, increased bacterial load and increased production of reactive oxygen species (ROS) in the hemolymph. Phagocytosis of latex beads is normal, however flies pre-injected with S.aureus display a significant decrease in subsequent bead phagocytosis. Increased survival following infection with L.monocytogenes. Increased extracellular glutamate in the hemolymph. No effect on motor functions, adult weight and no increase in susceptibility to wounding. Induction of the antimicrobial peptides Drs and DptA in response to S.aureus or E.coli infection is not affected.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000439490 | 1-460 | Glutamate transporter polyphemus | |||
Sequence: MEPKSQDQAPNRDDPDLQTEPLTIAQSITSFYMYNPYEKRSVEVPLTNCDAFISLLKCVIGTGILAMPLAFRCSGFVMGTVMSILLMILLTYSIHLLIADMTECCRRRRVPQVSMPEAVRIAYEEGPKWINCFGRAAGFMTTCVLVFGQFLLCTVYLVFVSKNFKEIGDHYIERYNERYYVLVACLLLLPLFMIRRLKYLVPLNLISNFLLYAGFALIMYYLFNGLPNINDREMVTPPVEWIEFIAIAAFSLTAVGSMLVVEAHMAHPQSYLGLFGVLNLAVLFILLSNMFFGIIGYWRFGDNVHASITLNIPQDEILSQFIKVFIASGIFLSYPLNGFVVITVMFSDYENSEPRGRYRTLIEYVVRLLFLFLTGAVAIGVPNLAALTELEGAFSLSNLNLLCPALIDVFLNYNVGYGRLMWKLIRDILLILIGLIFGIVGCTVALMQLIRDFQLTLNSM |
Proteomic databases
Expression
Developmental stage
Expressed in the hemolymph of larvae and adults.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q4V5R4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameA
- Length460
- Mass (Da)52,035
- Last updated2006-10-03 v1
- Checksum0B088DD47C0F4A97
Q4V5R4-2
- NameC
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE013599 EMBL· GenBank· DDBJ | AAF58727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE013599 EMBL· GenBank· DDBJ | AHN56099.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT022592 EMBL· GenBank· DDBJ | AAY55008.1 EMBL· GenBank· DDBJ | mRNA |