Q4KL25 · LHPL5_MOUSE
- ProteinLHFPL tetraspan subfamily member 5 protein
- GeneLhfpl5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids219 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Auxiliary subunit of the mechanotransducer (MET) non-specific cation channel complex located at the tips of the shorter stereocilia of cochlear hair cells and that mediates sensory transduction in the auditory system (PubMed:15905332, PubMed:23217710, PubMed:36191207).
The MET complex is composed of two dimeric pore-forming ion-conducting transmembrane TMC (TMC1 or TMC2) subunits, and aided by several auxiliary proteins including LHFPL5, TMIE, CIB2/3 and TOMT, and the tip-link PCDH15 (PubMed:23217710, PubMed:36191207).
Functionally couples PCDH15 to the transduction channel (PubMed:23217710).
The MET complex is composed of two dimeric pore-forming ion-conducting transmembrane TMC (TMC1 or TMC2) subunits, and aided by several auxiliary proteins including LHFPL5, TMIE, CIB2/3 and TOMT, and the tip-link PCDH15 (PubMed:23217710, PubMed:36191207).
Functionally couples PCDH15 to the transduction channel (PubMed:23217710).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical plasma membrane | |
Cellular Component | plasma membrane | |
Cellular Component | stereocilium bundle | |
Cellular Component | stereocilium tip | |
Biological Process | auditory receptor cell stereocilium organization | |
Biological Process | detection of mechanical stimulus involved in sensory perception | |
Biological Process | detection of mechanical stimulus involved in sensory perception of sound | |
Biological Process | monoatomic ion transport | |
Biological Process | sensory perception of sound |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameLHFPL tetraspan subfamily member 5 protein
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ4KL25
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Note: Efficient localization to the plasma membrane requires the presence of PCDH15.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-24 | Cytoplasmic | ||||
Sequence: MVKLLPAQEAAKIYHTNYVRNSRA | ||||||
Transmembrane | 25-45 | Helical | ||||
Sequence: VGVMWGTLTICFSVLVMALFI | ||||||
Topological domain | 46-98 | Extracellular | ||||
Sequence: QPYWIGDSVSTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAM | ||||||
Transmembrane | 99-119 | Helical | ||||
Sequence: FFVALAMFLIIGSIICFSLFF | ||||||
Topological domain | 120-128 | Cytoplasmic | ||||
Sequence: VCNTATVYK | ||||||
Transmembrane | 129-149 | Helical | ||||
Sequence: ICAWMQLAAATGLMIGCLVYP | ||||||
Topological domain | 150-178 | Extracellular | ||||
Sequence: DGWDSSEVRRMCGEQTGKYTLGHCTIRWA | ||||||
Transmembrane | 179-199 | Helical | ||||
Sequence: FMLAILSIGDALILSFLAFVL | ||||||
Topological domain | 200-219 | Cytoplasmic | ||||
Sequence: GYRQDKLLPDDYKADGNEEV |
Keywords
- Cellular component
Phenotypes & Variants
Involvement in disease
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 161 | in hscy | ||||
Sequence: C → F |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 14 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000285923 | 1-219 | LHFPL tetraspan subfamily member 5 protein | |||
Sequence: MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVSTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALAMFLIIGSIICFSLFFVCNTATVYKICAWMQLAAATGLMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFMLAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGNEEV |
Proteomic databases
Expression
Tissue specificity
Brain, inner ear hair cells and vestibular neuroepithelia of the inner ear (PubMed:15905332, PubMed:16459341, PubMed:23217710).
In inner ear, expressed in stereocilia in a punctate pattern and at the tip-link region (at protein level) (PubMed:15905332, PubMed:16459341, PubMed:23217710).
Strongly expressed in brain (PubMed:26964900).
Weakly expressed in heart, testis and intestine (PubMed:26964900).
In inner ear, expressed in stereocilia in a punctate pattern and at the tip-link region (at protein level) (PubMed:15905332, PubMed:16459341, PubMed:23217710).
Strongly expressed in brain (PubMed:26964900).
Weakly expressed in heart, testis and intestine (PubMed:26964900).
Developmental stage
Expressed in inner ear hair cells at 16.5 dpc. Expressed postnatally in inner and outer hair cells of the cochlear, as well as in vestibular hair cells. At the cochlear apex, levels are low at P1 and increased thereafter. After P7, hardly detectable at the protein level, while mRNA levels remains high in adult hair cells.
Gene expression databases
Interaction
Subunit
Forms the MET channel composed of TMC (TMC1 or TMC2), TMIE, TOMT, CIB (CIB2 or CIB3), LHPL5 and PCDH15 (PubMed:23217710, PubMed:25467981, PubMed:28504928).
Interaction with PCDH15 is required for efficient localization to hair bundles (PubMed:23217710).
Interaction with PCDH15 is required for efficient localization to hair bundles (PubMed:23217710).
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length219
- Mass (Da)24,186
- Last updated2005-08-02 v1
- Checksum9BFC49260AE9DD02
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CT009661 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC099483 EMBL· GenBank· DDBJ | AAH99483.1 EMBL· GenBank· DDBJ | mRNA |