Q4ACW4 · CD1D_PANTR
- ProteinAntigen-presenting glycoprotein CD1d
- GeneCD1D
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids335 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 98 | a D-galactosylceramide (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 169 | a D-galactosylceramide (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 169-172 | a D-galactosylceramide (UniProtKB | ChEBI) | ||||
Sequence: DKWT | ||||||
Binding site | 172 | a D-galactosylceramide (UniProtKB | ChEBI) | ||||
Sequence: T |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | basolateral plasma membrane | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | endosome membrane | |
Cellular Component | external side of plasma membrane | |
Cellular Component | extracellular space | |
Cellular Component | lysosomal membrane | |
Cellular Component | lysosome | |
Molecular Function | endogenous lipid antigen binding | |
Molecular Function | exogenous lipid antigen binding | |
Molecular Function | lipid antigen binding | |
Molecular Function | lipopeptide binding | |
Biological Process | antigen processing and presentation, endogenous lipid antigen via MHC class Ib | |
Biological Process | antigen processing and presentation, exogenous lipid antigen via MHC class Ib | |
Biological Process | immune response | |
Biological Process | innate immune response | |
Biological Process | positive regulation of T cell mediated cytotoxicity |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAntigen-presenting glycoprotein CD1d
- CD Antigen Name
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Pan
Accessions
- Primary accessionQ4ACW4
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Basolateral cell membrane ; Single-pass type I membrane protein
Endosome membrane ; Single-pass type I membrane protein
Lysosome membrane ; Single-pass type I membrane protein
Endoplasmic reticulum membrane ; Single-pass type I membrane protein
Note: Subject to intracellular trafficking between the cell membrane, endosomes and lysosomes.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 20-301 | Extracellular | ||||
Sequence: EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELEKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQDTQPGDILPNADETWYLRATLDVAAGEAAGLSCRVKHSSLEGQDIILYWGGSYTS | ||||||
Transmembrane | 302-322 | Helical | ||||
Sequence: VGLIVLAVLACLLFLLIVGFT | ||||||
Topological domain | 323-335 | Cytoplasmic | ||||
Sequence: SRFKRQTSYQGVL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MGCLLFLLLWALLQAWGSA | ||||||
Chain | PRO_0000042220 | 20-335 | Antigen-presenting glycoprotein CD1d | |||
Sequence: EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELEKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQDTQPGDILPNADETWYLRATLDVAAGEAAGLSCRVKHSSLEGQDIILYWGGSYTSVGLIVLAVLACLLFLLIVGFTSRFKRQTSYQGVL | ||||||
Glycosylation | 38 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 60 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 126 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 181 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Heterodimer with B2M (beta-2-microglobulin). Interacts with MHC II (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 185-292 | Ig-like | ||||
Sequence: PQFVSGLLESGKSELEKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQDTQPGDILPNADETWYLRATLDVAAGEAAGLSCRVKHSSLEGQDII | ||||||
Motif | 331-334 | Internalization signal | ||||
Sequence: YQGV |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length335
- Mass (Da)37,758
- Last updated2005-09-13 v1
- Checksum2F90B2741110001D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB222997 EMBL· GenBank· DDBJ | BAE16552.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB222998 EMBL· GenBank· DDBJ | BAE16553.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB223044 EMBL· GenBank· DDBJ | BAE16753.2 EMBL· GenBank· DDBJ | Genomic DNA |