Q49GP3 · PI4KB_DANRE
- ProteinPhosphatidylinositol 4-kinase beta
- Genepi4kb
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids835 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May play an important role the in inner ear development (PubMed:33358777).
Catalytic activity
- a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ADP + H+This reaction proceeds in the forward direction.
Cofactor
Mn2+ (UniProtKB | Rhea| CHEBI:29035 )
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | membrane | |
Cellular Component | mitochondrial outer membrane | |
Cellular Component | rough endoplasmic reticulum membrane | |
Molecular Function | 1-phosphatidylinositol 4-kinase activity | |
Molecular Function | ATP binding | |
Biological Process | cilium assembly | |
Biological Process | inner ear development | |
Biological Process | inner ear morphogenesis | |
Biological Process | inner ear receptor cell development | |
Biological Process | phosphatidylinositol phosphate biosynthetic process | |
Biological Process | phosphatidylinositol-mediated signaling | |
Biological Process | semicircular canal development |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePhosphatidylinositol 4-kinase beta
- EC number
- Short namesPI4K-beta; PI4Kbeta; PtdIns 4-kinase beta
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ49GP3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion outer membrane ; Peripheral membrane protein
Rough endoplasmic reticulum membrane ; Peripheral membrane protein
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Knockdown of the gene causes inner ear abnormalities and audiosensory impairment. The semicircular canals of the morphant inner ear are unable to form the characteristic cruciform pattern, resulting in a lack of canal outgrowths and failure of the pillar to properly fuse. In addition the otic vesicles are smaller in the morphants than in wild-type larvae. The morphants also show reduced hearing ability, lacking the brisk startle response observed in wild-type animals at 4 days post-fertilization.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000365169 | 1-835 | Phosphatidylinositol 4-kinase beta | |||
Sequence: MGDTELELSPTHLEELQKSPSTSTTSSLSLPSSPSSGPHPLTSSSPSTSEGLPTSSPPLDVISEGLGELSLVIDTEVAKKACQEVLQKVKFLKGDGEVSSASSEPILANGTAHPEANDGGQPPKISEEEVEPIKSVRRRQKNNSSKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFSFRNEDVDFYLPQLLNMYIHMDEDVGDAIKPYVVYRCRQSINFSLQCAWLLGAYSSDMHISTQRHSRGTKLRKLILSDELKPSSQRIRREVPQPPPPYPPPLHHGPGMSEHSLSPSKRTHQRSKSDATVSISLSSNLKRTASNPKVETSQDEPVRLTPQREFIKSLMGIGKRLATLPTKEQKTQRLISELSLLNHKLPARVWLPTAAFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFETSSVPVRIPETQIRSTRSVENLPDCGITPDQRASSFSTVPNYDNDDEAWSVDDIGELQVELPEIHTNSCDNISQFSVDSITSQESKEPIFIAAGDIRRRLSEQLAHTPTTFRKDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAYQVLKQLQIIWEQERVPLWIKPYKILVISSDSGMIEPVVNAVSIHQVKKQSQLLLLDYFRQEHGNFNTEEFLTAQRNFVQSCAGYCLICYLLQVKDRHNGNILLDSEGHIIHIDFGFILSSSPRNLGFETSAFKLTSEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMEKVIQIVEIMQQGSQLPCFHGSSTIRNLKERFHMNLTEEQLQVLVEQMVDGSMRSITTKLYDGFQYLTNGIM |
Proteomic databases
Expression
Tissue specificity
Expressed in the inner ear otic vesicles.
Developmental stage
Expressed as early as 26 hours post-fertilization.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-61 | Disordered | ||||
Sequence: MGDTELELSPTHLEELQKSPSTSTTSSLSLPSSPSSGPHPLTSSSPSTSEGLPTSSPPLDV | ||||||
Compositional bias | 14-56 | Polar residues | ||||
Sequence: EELQKSPSTSTTSSLSLPSSPSSGPHPLTSSSPSTSEGLPTSS | ||||||
Domain | 59-262 | PIK helical | ||||
Sequence: LDVISEGLGELSLVIDTEVAKKACQEVLQKVKFLKGDGEVSSASSEPILANGTAHPEANDGGQPPKISEEEVEPIKSVRRRQKNNSSKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFSFRNEDVDFYLPQLLNMYIHMDEDVGDAIKPYVVYRCRQSINFSLQCAWLLGAYSSDMHISTQRHSRGTKLRKLILS | ||||||
Region | 99-139 | Disordered | ||||
Sequence: SSASSEPILANGTAHPEANDGGQPPKISEEEVEPIKSVRRR | ||||||
Compositional bias | 122-138 | Basic and acidic residues | ||||
Sequence: PPKISEEEVEPIKSVRR | ||||||
Region | 267-341 | Disordered | ||||
Sequence: PSSQRIRREVPQPPPPYPPPLHHGPGMSEHSLSPSKRTHQRSKSDATVSISLSSNLKRTASNPKVETSQDEPVRL | ||||||
Compositional bias | 274-289 | Pro residues | ||||
Sequence: REVPQPPPPYPPPLHH | ||||||
Compositional bias | 310-340 | Polar residues | ||||
Sequence: SDATVSISLSSNLKRTASNPKVETSQDEPVR | ||||||
Domain | 554-820 | PI3K/PI4K catalytic | ||||
Sequence: EPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAYQVLKQLQIIWEQERVPLWIKPYKILVISSDSGMIEPVVNAVSIHQVKKQSQLLLLDYFRQEHGNFNTEEFLTAQRNFVQSCAGYCLICYLLQVKDRHNGNILLDSEGHIIHIDFGFILSSSPRNLGFETSAFKLTSEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMEKVIQIVEIMQQGSQLPCFHGSSTIRNLKERFHMNLTEEQLQVLVEQMVDGSMRSIT | ||||||
Region | 560-566 | G-loop | ||||
Sequence: VRRIREG | ||||||
Region | 687-695 | Catalytic loop | ||||
Sequence: QVKDRHNGN | ||||||
Region | 706-730 | Activation loop | ||||
Sequence: HIDFGFILSSSPRNLGFETSAFKLT |
Sequence similarities
Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length835
- Mass (Da)94,059
- Last updated2009-03-03 v2
- ChecksumDE044DB4C925B795
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M2B4L5 | A0A8M2B4L5_DANRE | pi4kb | 848 | ||
F1RBR8 | F1RBR8_DANRE | pi4kb | 850 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 14-56 | Polar residues | ||||
Sequence: EELQKSPSTSTTSSLSLPSSPSSGPHPLTSSSPSTSEGLPTSS | ||||||
Sequence conflict | 100 | in Ref. 1; AAY16568 | ||||
Sequence: S → L | ||||||
Compositional bias | 122-138 | Basic and acidic residues | ||||
Sequence: PPKISEEEVEPIKSVRR | ||||||
Compositional bias | 274-289 | Pro residues | ||||
Sequence: REVPQPPPPYPPPLHH | ||||||
Compositional bias | 310-340 | Polar residues | ||||
Sequence: SDATVSISLSSNLKRTASNPKVETSQDEPVR | ||||||
Sequence conflict | 370 | in Ref. 3; AAI24585 | ||||
Sequence: R → G |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY929293 EMBL· GenBank· DDBJ | AAY16568.1 EMBL· GenBank· DDBJ | mRNA | ||
FJ032032 EMBL· GenBank· DDBJ | ACH92118.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
BC124584 EMBL· GenBank· DDBJ | AAI24585.1 EMBL· GenBank· DDBJ | mRNA |