Q47422 · GSPM_DICCH
- ProteinType II secretion system protein M
- GeneoutM
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids161 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Inner membrane component of the type II secretion system required for the energy-dependent secretion of extracellular factors such as proteases and toxins from the periplasm. Plays a role in the complex assembly and recruits OutL resulting in a stable complex in the inner membrane (By similarity).
Provides thus a link between the energy-providing OutE protein in the cytoplasm and the rest of the T2SS machinery (PubMed:11266368).
Provides thus a link between the energy-providing OutE protein in the cytoplasm and the rest of the T2SS machinery (PubMed:11266368).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Cellular Component | type II protein secretion system complex | |
Biological Process | protein secretion by the type II secretion system |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameType II secretion system protein M
- Short namesT2SS protein M
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Pectobacteriaceae > Dickeya
Accessions
- Primary accessionQ47422
Subcellular Location
UniProt Annotation
GO Annotation
Cell inner membrane ; Single-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-16 | Cytoplasmic | ||||
Sequence: MNELRRRWQVMSQRER | ||||||
Transmembrane | 17-37 | Helical | ||||
Sequence: LMALACGGLVVLCLLYYLIWA | ||||||
Topological domain | 38-161 | Periplasmic | ||||
Sequence: PWQESVRQWQMTVERERQTVRWMQQQPPRFRRRKVRGGRXPVAISANGIGAQSAVRYGITVLRMQPQESQVSVTLARSDFNNLLHWLAELEQKNGVITQGIDVTAVPNSPGIVEVTRLSLERVL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000207325 | 1-161 | Type II secretion system protein M | |||
Sequence: MNELRRRWQVMSQRERLMALACGGLVVLCLLYYLIWAPWQESVRQWQMTVERERQTVRWMQQQPPRFRRRKVRGGRXPVAISANGIGAQSAVRYGITVLRMQPQESQVSVTLARSDFNNLLHWLAELEQKNGVITQGIDVTAVPNSPGIVEVTRLSLERVL |
Interaction
Subunit
Type II secretion system is composed of four main components: the outer membrane complex, the inner membrane complex, the cytoplasmic secretion ATPase and the periplasm-spanning pseudopilus (By similarity).
Forms homodimers (By similarity).
Interacts with OutL/GspL (PubMed:11266368).
Interacts with OutE/GspE and OutF/GspF (By similarity).
Forms homodimers (By similarity).
Interacts with OutL/GspL (PubMed:11266368).
Interacts with OutE/GspE and OutF/GspF (By similarity).
Structure
Sequence
- Sequence statusComplete
- Length161
- Mass (Da)18,622
- Last updated1996-11-01 v1
- ChecksumDDEDD3C69345D920