Q42472 · DCE2_ARATH
- ProteinGlutamate decarboxylase 2
- GeneGAD2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids494 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Catalyzes the conversion of glutamate to 4-aminobutanoate (GABA). The calmodulin-binding is calcium-dependent and it is proposed to directly or indirectly form a calcium regulated control of GABA biosynthesis.
Catalytic activity
- H+ + L-glutamate = 4-aminobutanoate + CO2This reaction proceeds in the forward direction.
Cofactor
Activity regulation
Up-regulated by calmodulin binding at physiological pH.
pH Dependence
Optimum pH is 6.0.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 488 | Anchoring site for calmodulin binding; modulates the equilibrium between pyridoxal phosphate tautomers | ||||
Sequence: K | ||||||
Site | 489 | Anchoring site for calmodulin binding; modulates the equilibrium between pyridoxal phosphate tautomers | ||||
Sequence: K |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Molecular Function | calmodulin binding | |
Molecular Function | glutamate decarboxylase activity | |
Molecular Function | pyridoxal phosphate binding | |
Biological Process | glutamate metabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlutamate decarboxylase 2
- EC number
- Short namesGAD 2
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ42472
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Disruption phenotype
No visible phenotype.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 13 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000146974 | 1-494 | Glutamate decarboxylase 2 | |||
Sequence: MVLTKTATNDESVCTMFGSRYVRTTLPKYEIGENSIPKDAAYQIIKDELMLDGNPRLNLASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNIIARLFNAPLEESETAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVNLSEGYYVMDPDKAAEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVKKNEETGWNTPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRAAEDLPEELIFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNVMENCIENMVVLKEGIEKTERFNIVSKDQGVPVVAFSLKDHSFHNEFEISEMLRRFGWIVPAYTMPADAQHITVLRVVIREDFSRTLAERLVADISKVLHELDTLPSKISKKMGIEGIAENVKEKKMEKEILMEVIVGWRKFVKERKKMNGVC | ||||||
Modified residue | 276 | N6-(pyridoxal phosphate)lysine | ||||
Sequence: K |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in roots, inflorescence stems, flowers, siliques and leaves.
Induction
Up-regulated by salt treatment (PubMed:20122158).
Up-regulated by nitrogen treatments such as ammonium chloride, ammonium nitrate, glutamate and glutamine but not by potassium nitrate (PubMed:9701597).
Down-regulated by hypoxia (PubMed:18077464).
Up-regulated by nitrogen treatments such as ammonium chloride, ammonium nitrate, glutamate and glutamine but not by potassium nitrate (PubMed:9701597).
Down-regulated by hypoxia (PubMed:18077464).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 463-494 | Calmodulin-binding | ||||
Sequence: VKEKKMEKEILMEVIVGWRKFVKERKKMNGVC |
Domain
The C-terminus (463-494) binds calmodulin in a calcium-dependent fashion.
Sequence similarities
Belongs to the group II decarboxylase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
This entry describes 1 isoforms produced by Alternative splicing. A number of isoforms are produced. According to EST sequences.
Q42472-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length494
- Mass (Da)56,141
- Last updated1997-11-01 v1
- Checksum741E83A25DCBC48C
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q56W28 | Q56W28_ARATH | GAD2 | 365 |
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 410 | in Ref. 5; AAL16126 | ||||
Sequence: A → V | ||||||
Sequence conflict | 461 | in Ref. 5; AAL91148 | ||||
Sequence: E → K |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U49937 EMBL· GenBank· DDBJ | AAC31617.1 EMBL· GenBank· DDBJ | mRNA | ||
U46665 EMBL· GenBank· DDBJ | AAC33485.1 EMBL· GenBank· DDBJ | mRNA | ||
AC009513 EMBL· GenBank· DDBJ | AAF06056.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE34445.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF428294 EMBL· GenBank· DDBJ | AAL16126.1 EMBL· GenBank· DDBJ | mRNA | ||
AF428372 EMBL· GenBank· DDBJ | AAL16302.1 EMBL· GenBank· DDBJ | mRNA | ||
AY124873 EMBL· GenBank· DDBJ | AAM70582.1 EMBL· GenBank· DDBJ | mRNA | ||
AY081259 EMBL· GenBank· DDBJ | AAL91148.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |