Q42381 · HLS1_ARATH
- ProteinProbable N-acetyltransferase HLS1
- GeneHLS1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids403 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Ethylene-responsive N-acetyltransferase required for differential cell elongation in the hypocotyl. Regulates apical hook formation of dark-grown seedlings. May control differential cell growth by regulating auxin activity. May be involved in negative feedback regulation of auxin homeostasis through the control of GH3-like genes. Modulates de novo shoot organogenesis.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | N-acetyltransferase activity | |
Biological Process | auxin-activated signaling pathway | |
Biological Process | photomorphogenesis | |
Biological Process | response to ethylene | |
Biological Process | unidimensional cell growth |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProbable N-acetyltransferase HLS1
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ42381
Proteomes
Organism-specific databases
Genome annotation databases
Phenotypes & Variants
Disruption phenotype
Unable to develop apical hook in the dark. Reduced length of dark-grown hypocotyls and reduced leaf initiation rate in light-grown seedlings.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 327 | In hls1-6; strong allele. | ||||
Sequence: L → W | ||||||
Mutagenesis | 346 | In hls1-1 and hls4-1; strong allele. | ||||
Sequence: E → K |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 30 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000423403 | 1-403 | Probable N-acetyltransferase HLS1 | |||
Sequence: MTVVREYDPTRDLVGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSYLMLVAEMGTEKKEIVGMIRGCIKTVTCGQKLDLNHKSQNDVVKPLYTKLAYVLGLRVSPFHRRQGIGFKLVKMMEEWFRQNGAEYSYIATENDNQASVNLFTGKCGYSEFRTPSILVNPVYAHRVNVSRRVTVIKLEPVDAETLYRIRFSTTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWPGSAKFLEYPPESWAVLSVWNCKDSFLLEVRGASRLRRVVAKTTRVVDKTLPFLKLPSIPSVFEPFGLHFMYGIGGEGPRAVKMVKSLCAHAHNLAKAGGCGVVAAEVAGEDPLRRGIPHWKVLSCDEDLWCIKRLGDDYSDGVVGDWTKSPPGVSIFVDPREF |
Proteomic databases
Expression
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q42381 | CAF1-6 Q9SAI2 | 4 | EBI-15207218, EBI-4465274 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-177 | N-acetyltransferase | ||||
Sequence: TVVREYDPTRDLVGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSYLMLVAEMGTEKKEIVGMIRGCIKTVTCGQKLDLNHKSQNDVVKPLYTKLAYVLGLRVSPFHRRQGIGFKLVKMMEEWFRQNGAEYSYIATENDNQASVNLFTGKCGYSEFRTPSILVNPVYAHRVN |
Sequence similarities
Belongs to the acetyltransferase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length403
- Mass (Da)44,934
- Last updated1996-11-01 v1
- ChecksumE2A9DD0C2FA2DFE8
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8B3D5 | A0A1P8B3D5_ARATH | HLS1 | 346 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U50399 EMBL· GenBank· DDBJ | AAB03773.1 EMBL· GenBank· DDBJ | mRNA | ||
U50400 EMBL· GenBank· DDBJ | AAB03774.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL035605 EMBL· GenBank· DDBJ | CAB38297.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL161591 EMBL· GenBank· DDBJ | CAB80423.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002687 EMBL· GenBank· DDBJ | AEE86813.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK175660 EMBL· GenBank· DDBJ | BAD43423.1 EMBL· GenBank· DDBJ | mRNA | ||
AK176117 EMBL· GenBank· DDBJ | BAD43880.1 EMBL· GenBank· DDBJ | mRNA | ||
BT026435 EMBL· GenBank· DDBJ | ABH04542.1 EMBL· GenBank· DDBJ | mRNA |