Q40638 · EXPB1_ORYSJ
- ProteinExpansin-B1
- GeneEXPB1a; EXPB1b
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids267 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | membrane | |
Biological Process | anatomical structure morphogenesis | |
Biological Process | plant-type cell wall loosening | |
Biological Process | sexual reproduction |
Keywords
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameExpansin-B1
- Alternative names
- Allergen nameOry s 1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ40638
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Allergenic properties
Causes an allergic reaction in human. Causes grass pollen allergy. Binds to IgE.
Keywords
- Disease
Protein family/group databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MASSSLLLACVVVAAMVSAVSC | ||||||
Chain | PRO_0000008721 | 23-267 | Expansin-B1 | |||
Sequence: GPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQAK | ||||||
Glycosylation | 32 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 64↔92 | |||||
Sequence: CGYKDVDKAPFLGMNSCGNDPIFKDGKGC | ||||||
Disulfide bond | 95↔162 | |||||
Sequence: CFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKC | ||||||
Disulfide bond | 100↔106 | |||||
Sequence: CSKPEAC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in mature anthers but not in vegetative or other floral tissues.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 61-167 | Expansin-like EG45 | ||||
Sequence: GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPAD | ||||||
Domain | 181-262 | Expansin-like CBD | ||||
Sequence: NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKS |
Sequence similarities
Belongs to the expansin family. Expansin B subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length267
- Mass (Da)28,627
- Last updated2006-05-30 v2
- Checksum3B89E1FE02D5A5DC
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U31771 EMBL· GenBank· DDBJ | AAA86533.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AF261270 EMBL· GenBank· DDBJ | AAF72983.1 EMBL· GenBank· DDBJ | mRNA | ||
AY039023 EMBL· GenBank· DDBJ | AAK84682.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC107224 EMBL· GenBank· DDBJ | AAN60487.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC107224 EMBL· GenBank· DDBJ | AAN60491.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DP000009 EMBL· GenBank· DDBJ | ABF93540.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DP000009 EMBL· GenBank· DDBJ | ABF93536.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008209 EMBL· GenBank· DDBJ | BAF10600.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008209 EMBL· GenBank· DDBJ | BAF10603.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014959 EMBL· GenBank· DDBJ | BAS81873.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014959 EMBL· GenBank· DDBJ | BAS81878.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000140 EMBL· GenBank· DDBJ | EAZ25286.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK072792 EMBL· GenBank· DDBJ | BAG93147.1 EMBL· GenBank· DDBJ | mRNA |