Q3ZU82 · GOGA5_RAT
- ProteinGolgin subfamily A member 5
- GeneGolga5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids728 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in maintaining Golgi structure. Stimulates the formation of Golgi stacks and ribbons. Involved in intra-Golgi retrograde transport.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cis-Golgi network | |
Cellular Component | COPI-coated vesicle membrane | |
Cellular Component | Golgi apparatus | |
Cellular Component | Golgi cis cisterna | |
Cellular Component | Golgi cisterna | |
Cellular Component | Golgi medial cisterna | |
Cellular Component | Golgi membrane | |
Cellular Component | Golgi trans cisterna | |
Cellular Component | membrane | |
Molecular Function | protein homodimerization activity | |
Molecular Function | protein-macromolecule adaptor activity | |
Molecular Function | small GTPase binding | |
Biological Process | Golgi organization | |
Biological Process | Golgi vesicle transport | |
Biological Process | retrograde transport, vesicle recycling within Golgi |
Names & Taxonomy
Protein names
- Recommended nameGolgin subfamily A member 5
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ3ZU82
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Single-pass type IV membrane protein
Note: Found throughout the Golgi.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 2-695 | Cytoplasmic | ||||
Sequence: SWFADLAGRAEDLLNRVDQGAATALRKESTSNTFYSKNTDYPELHQQNTDSTYHTGQKANYISSAADNIRHQKATIIAGTANVKVGSRTGGDASHPTEHASVPRPSSHFVRRKKSEPDDELLFDFLNSSQKEPTGRVEIKKEKGKAPVLPSSQSSAVSSVTTSVTTIKATEENSGSQSPEVSSSDSMPEGHKKSTEESTVSNAISVEHSSVPSDGSMSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNEARVRVEKWNVDNSKSDRITRELRAQVDDLTEAVAAKDSQLAVLKVRLQEADQVLSSRTEALEALQSEKSRIMQDHNEGSSLQNQALQTLQERHEADATLKREQESYKQMQSEFATRLNKMEVERQNLAEAVTLAERKYSEERKKVDDLQQQVKLHRSSLESAKQELVDYKQKATRILQSKEKLINSLKEGSSFEGLDSSTASSMELEELRHERELQKEEIQKLMGQIHQLRSELQDMEAQQVSEAESAREQLQDLQDQIAKQRASKQELETELDRMKQEFHYVEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQSELESRLHQLTETLIQKQTLLESLSTEKNSLVFQLERLEQQLHSAATGPSSGSSINMSGVDSGEGTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIAR | ||||||
Transmembrane | 696-716 | Helical; Anchor for type IV membrane protein | ||||
Sequence: VFVIIYMALLHLWVMIVLLTY | ||||||
Topological domain | 717-728 | Lumenal | ||||
Sequence: SPEMHHDQPYGK |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylserine | ||||
Sequence: S | ||||||
Chain | PRO_0000190063 | 2-728 | Golgin subfamily A member 5 | |||
Sequence: SWFADLAGRAEDLLNRVDQGAATALRKESTSNTFYSKNTDYPELHQQNTDSTYHTGQKANYISSAADNIRHQKATIIAGTANVKVGSRTGGDASHPTEHASVPRPSSHFVRRKKSEPDDELLFDFLNSSQKEPTGRVEIKKEKGKAPVLPSSQSSAVSSVTTSVTTIKATEENSGSQSPEVSSSDSMPEGHKKSTEESTVSNAISVEHSSVPSDGSMSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNEARVRVEKWNVDNSKSDRITRELRAQVDDLTEAVAAKDSQLAVLKVRLQEADQVLSSRTEALEALQSEKSRIMQDHNEGSSLQNQALQTLQERHEADATLKREQESYKQMQSEFATRLNKMEVERQNLAEAVTLAERKYSEERKKVDDLQQQVKLHRSSLESAKQELVDYKQKATRILQSKEKLINSLKEGSSFEGLDSSTASSMELEELRHERELQKEEIQKLMGQIHQLRSELQDMEAQQVSEAESAREQLQDLQDQIAKQRASKQELETELDRMKQEFHYVEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQSELESRLHQLTETLIQKQTLLESLSTEKNSLVFQLERLEQQLHSAATGPSSGSSINMSGVDSGEGTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYSPEMHHDQPYGK | ||||||
Modified residue | 27 | Dimethylated arginine | ||||
Sequence: R | ||||||
Modified residue | 89 | Dimethylated arginine | ||||
Sequence: R | ||||||
Modified residue | 116 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Highly phosphorylated during mitosis. Phosphorylation is barely detectable during interphase (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Homodimer. Interacts with RAB1A that has been activated by GTP-binding. Interacts with isoform CASP of CUX1.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 88-202 | Disordered | ||||
Sequence: SRTGGDASHPTEHASVPRPSSHFVRRKKSEPDDELLFDFLNSSQKEPTGRVEIKKEKGKAPVLPSSQSSAVSSVTTSVTTIKATEENSGSQSPEVSSSDSMPEGHKKSTEESTVS | ||||||
Compositional bias | 149-186 | Polar residues | ||||
Sequence: VLPSSQSSAVSSVTTSVTTIKATEENSGSQSPEVSSSD | ||||||
Coiled coil | 216-628 | |||||
Sequence: GSMSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNEARVRVEKWNVDNSKSDRITRELRAQVDDLTEAVAAKDSQLAVLKVRLQEADQVLSSRTEALEALQSEKSRIMQDHNEGSSLQNQALQTLQERHEADATLKREQESYKQMQSEFATRLNKMEVERQNLAEAVTLAERKYSEERKKVDDLQQQVKLHRSSLESAKQELVDYKQKATRILQSKEKLINSLKEGSSFEGLDSSTASSMELEELRHERELQKEEIQKLMGQIHQLRSELQDMEAQQVSEAESAREQLQDLQDQIAKQRASKQELETELDRMKQEFHYVEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQSELESRLHQLTETLIQKQTLLESLSTEKNSLVFQLERLEQQLHSAAT |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length728
- Mass (Da)82,334
- Last updated2005-09-27 v1
- Checksum0C30FCB93C8E310A
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
G3V6Z7 | G3V6Z7_RAT | Golga5 | 729 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 149-186 | Polar residues | ||||
Sequence: VLPSSQSSAVSSVTTSVTTIKATEENSGSQSPEVSSSD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY144587 EMBL· GenBank· DDBJ | AAN17671.1 EMBL· GenBank· DDBJ | mRNA |