Q3UUV5 · SKAP1_MOUSE
- ProteinSrc kinase-associated phosphoprotein 1
- GeneSkap1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids355 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway (By similarity).
Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells (By similarity).
May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells (PubMed:12681493).
Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells (By similarity).
May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells (PubMed:12681493).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSrc kinase-associated phosphoprotein 1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ3UUV5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Upon T-cell stimulation, translocates to lipid rafts at the cell membrane.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000270174 | 1-355 | Src kinase-associated phosphoprotein 1 | |||
Sequence: MQAVALPEEICWLLEDTEDFLAEGLQNENLSPGAQDQRAHILRGFQQIKSRYCWDFQPQGGDLGQDGSDDNLSGTHGPPLTSEASFWSDYQDEGIEDILRGAQELDSVIKQGYLEKKSKDHSFFGSEWQKRWCVISRGLFLYYANEKSKQPKGTFLIKGYSVRMAPHLRKDSKKESCFELISQDRRSYEFTASSPAEARDWVDQISFLLKDLSSLTIPFEEEEEEEEEEEKEEEEMYNDVDGFDSPRSGSQCRAMALPEPTEKEEDIYEVLPDDDDLEEDTCGAHRRRVDYADYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSVIGIVPKDYLTTAFEMEGI | ||||||
Modified residue | 142 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 237 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 268 | Phosphotyrosine; by FYN | ||||
Sequence: Y | ||||||
Modified residue | 291 | Phosphotyrosine; by FYN | ||||
Sequence: Y |
Post-translational modification
Phosphorylated on tyrosines. Phosphorylation by FYN on Tyr-268 is required for GRB2 interaction (By similarity).
Phosphorylation by FYN on Tyr-291 abolishes interaction with FYB1. Tyr-237 is dephosphorylated by PTPRC (By similarity).
Phosphorylation by FYN on Tyr-291 abolishes interaction with FYB1. Tyr-237 is dephosphorylated by PTPRC (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Homodimer (By similarity).
Interacts with FYN (PubMed:12681493).
Interacts with PTPRC (By similarity).
Interacts with GRB2 when phosphorylated on Tyr-268 (By similarity).
Interacts with FYB1, which is required for SKAP2 protein stability (By similarity).
Part of a complex consisting of SKAP1, FYB1 and CLNK (PubMed:12681493).
Interacts with RASGRP1 (By similarity).
Interacts with FYB2 (By similarity).
Interacts with FYN (PubMed:12681493).
Interacts with PTPRC (By similarity).
Interacts with GRB2 when phosphorylated on Tyr-268 (By similarity).
Interacts with FYB1, which is required for SKAP2 protein stability (By similarity).
Part of a complex consisting of SKAP1, FYB1 and CLNK (PubMed:12681493).
Interacts with RASGRP1 (By similarity).
Interacts with FYB2 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 64-83 | Disordered | ||||
Sequence: GQDGSDDNLSGTHGPPLTSE | ||||||
Domain | 107-210 | PH | ||||
Sequence: SVIKQGYLEKKSKDHSFFGSEWQKRWCVISRGLFLYYANEKSKQPKGTFLIKGYSVRMAPHLRKDSKKESCFELISQDRRSYEFTASSPAEARDWVDQISFLLK | ||||||
Compositional bias | 219-239 | Acidic residues | ||||
Sequence: FEEEEEEEEEEEKEEEEMYND | ||||||
Region | 219-252 | Disordered | ||||
Sequence: FEEEEEEEEEEEKEEEEMYNDVDGFDSPRSGSQC | ||||||
Region | 286-291 | Interaction with FYB1 | ||||
Sequence: RRRVDY | ||||||
Domain | 290-351 | SH3 | ||||
Sequence: DYADYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSVIGIVPKDYLTTAFE |
Domain
The SH3 domain interacts with FYB1.
Sequence similarities
Belongs to the SKAP family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
Q3UUV5-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length355
- Mass (Da)40,962
- Last updated2005-10-11 v1
- Checksum4DFE6CC655894B66
Q3UUV5-2
- Name2
Q3UUV5-3
- Name3
Q3UUV5-4
- Name4
- Differences from canonical
- 273-288: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_022180 | 95-148 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 219-239 | Acidic residues | ||||
Sequence: FEEEEEEEEEEEKEEEEMYND | ||||||
Alternative sequence | VSP_022181 | 273-288 | in isoform 2, isoform 3 and isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_022182 | 323-355 | in isoform 2 | |||
Sequence: EYNMYGWWVGELNSVIGIVPKDYLTTAFEMEGI → VKM | ||||||
Alternative sequence | VSP_022183 | 323-355 | in isoform 3 | |||
Sequence: EYNMYGWWVGELNSVIGIVPKDYLTTAFEMEGI → GTYSQTIRNSRPLLWPWILLFPEWSQDSAASCDFKPLIR | ||||||
Sequence conflict | 355 | in Ref. 1; BAE41394 | ||||
Sequence: I → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK137792 EMBL· GenBank· DDBJ | BAE23497.1 EMBL· GenBank· DDBJ | mRNA | ||
AK137942 EMBL· GenBank· DDBJ | BAE23518.1 EMBL· GenBank· DDBJ | mRNA | ||
AK138030 EMBL· GenBank· DDBJ | BAE23537.1 EMBL· GenBank· DDBJ | mRNA | ||
AK169825 EMBL· GenBank· DDBJ | BAE41394.1 EMBL· GenBank· DDBJ | mRNA |