Q3UAG2 · Q3UAG2_MOUSE
- Protein6-phosphogluconate dehydrogenase, decarboxylating
- GenePgd
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids483 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO2, with concomitant reduction of NADP to NADPH.
Catalytic activity
- 6-phospho-D-gluconate + NADP+ = D-ribulose 5-phosphate + CO2 + NADPH
Pathway
Carbohydrate degradation; pentose phosphate pathway; D-ribulose 5-phosphate from D-glucose 6-phosphate (oxidative stage): step 3/3.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 10-15 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: GLAVMG | ||||||
Binding site | 33-35 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: NRT | ||||||
Binding site | 75-77 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: VKA | ||||||
Binding site | 103 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 103 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: N | ||||||
Binding site | 129-131 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: SGG | ||||||
Active site | 184 | Proton acceptor | ||||
Sequence: K | ||||||
Binding site | 187-188 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: HN | ||||||
Active site | 191 | Proton donor | ||||
Sequence: E | ||||||
Binding site | 192 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: Y | ||||||
Binding site | 261 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: K | ||||||
Binding site | 288 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: R | ||||||
Binding site | 447 | substrate; ligand shared between dimeric partners | ||||
Sequence: R | ||||||
Binding site | 453 | substrate; ligand shared between dimeric partners | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | NADP binding | |
Molecular Function | phosphogluconate dehydrogenase (decarboxylating) activity | |
Biological Process | D-gluconate metabolic process | |
Biological Process | pentose-phosphate shunt |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name6-phosphogluconate dehydrogenase, decarboxylating
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ3UAG2
Organism-specific databases
PTM/Processing
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 180-470 | 6-phosphogluconate dehydrogenase C-terminal | ||||
Sequence: GHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMRHEEMAQAFEEWNKTELDSFLIEITANILKYRDTDGKELLPKIRDSAGQKGTGKWTAISALEYGMPVTLIGEAVFARCLSSLKEERVQASQKLKGPKVVQLEGSKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFERNPELQNLLLDDFFKSAVDNCQDSWRRVISTGVQAGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLTKPGEFIHTNWT |
Sequence similarities
Belongs to the 6-phosphogluconate dehydrogenase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length483
- Mass (Da)53,246
- Last updated2005-10-11 v1
- ChecksumCD0E2F72EEC2831E
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK150490 EMBL· GenBank· DDBJ | BAE29606.1 EMBL· GenBank· DDBJ | mRNA | ||
AK151380 EMBL· GenBank· DDBJ | BAE30352.1 EMBL· GenBank· DDBJ | mRNA | ||
AK151993 EMBL· GenBank· DDBJ | BAE30857.1 EMBL· GenBank· DDBJ | mRNA | ||
AK152758 EMBL· GenBank· DDBJ | BAE31473.1 EMBL· GenBank· DDBJ | mRNA | ||
AK152894 EMBL· GenBank· DDBJ | BAE31577.1 EMBL· GenBank· DDBJ | mRNA |