Q3U595 · CV039_MOUSE

  • Protein
    Synaptic plasticity regulator PANTS
  • Status
    UniProtKB reviewed (Swiss-Prot)
  • Amino acids
  • Protein existence
    Evidence at protein level
  • Annotation score
    4/5

Function

function

Negatively regulates long-term potentiation and modulates adult synaptic plasticity (PubMed:35771867).
Stabilizes the interaction of RTN4 isoform A/Nogo-A with its receptors, inhibiting clustering of postsynaptic AMPA receptors at synaptic sites (PubMed:35771867).
Upon neuronal stimulation, degraded at synapses, reducing RTN4 signaling and allowing AMPA receptor clustering at individual synapses (PubMed:35771867).

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentsynapse
Cellular Componentsynaptic cleft
Biological Processnegative regulation of long-term synaptic potentiation
Biological Processregulation of synaptic plasticity

Names & Taxonomy

Protein names

  • Recommended name
    Synaptic plasticity regulator PANTS
  • Alternative names
    • Plasticity-associated neural transcript short

Organism names

  • Taxonomic identifier
  • Strain
    • C57BL/6J
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus

Accessions

  • Primary accession
    Q3U595

Proteomes

Organism-specific databases

Subcellular Location

Synapse
Synaptic cleft
Note: Detected in both the presynaptic and postsynaptic regions of the synapse and is secreted from neurons into the synaptic cleft (PubMed:35771867).
May be released by neuronal dense core vesicles which mediate the release of cleaved neuropeptides (PubMed:35771867).

Keywords

PTM/Processing

Features

Showing features for chain.

TypeIDPosition(s)Description
ChainPRO_00003261311-105Synaptic plasticity regulator PANTS

Post-translational modification

Rapidly degraded by proteolysis following neuronal stimulation, resulting in increased AMPA receptor clustering.

Proteomic databases

PTM databases

Expression

Tissue specificity

In the postnatal brain, expressed diffusely throughout the hippocampus at a low level at 8 weeks (at protein level) (PubMed:29571919).
At 16 weeks, strongly expressed in the stratum lucidum of the hippocampus (at protein level) (PubMed:29571919).
In developing and aging brain, expression is strongest in hippocampus, especially in areas CA3 and CA2, throughout the dorsoventral axis (PubMed:29571919).

Developmental stage

Expression increases in the hippocampus between 8 and 16 weeks of age (at protein level) (PubMed:35771867).
In brain, expression decreases steadily throughout embryonic development (PubMed:29571919).
In liver, expression decreases between 11.5 dpc and 13.5 dpc and then remains relatively low (PubMed:29571919).
Expression in the heart shows a 50% increase between 11.5 dpc and 13.5 dpc and then decreases (PubMed:29571919).
In the postnatal brain, cerebellum levels decline (PubMed:29571919).
In cortical tissue, expression significantly decreases by ~40% between P0 and 3 weeks and then returns to levels comparable to P0 in adult stages (PubMed:29571919).
In the hippocampus, expression significantly drops by 40% between P0 and 3 weeks with a slight increase observed between 8 and 16 weeks of age (PubMed:29571919).

Gene expression databases

Interaction

Subunit

Interacts with RTN4 isoform A/Nogo-A; the interaction results in enhanced RTN4-mediated inhibition of AMPA receptor clustering (PubMed:35771867).
Also interacts with NCAM1, RANBP2 and CCT8 (PubMed:35771867).

Protein-protein interaction databases

Miscellaneous

Family & Domains

Sequence similarities

Belongs to the UPF0545 family.

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    105
  • Mass (Da)
    12,503
  • Last updated
    2005-10-11 v1
  • Checksum
    C312496CC7F3E53E
MAVAGSWQPPRPCEVYRAEWELCRSVGHVLHHYYVHGKRPDCRQWLRDLTNCREWEESRSAEAQRSLCESEQVRVQAAQKHTLVWALRQRPPTDWNLPLPQEKDK

Computationally mapped potential isoform sequences

There are 2 potential isoforms mapped to this entry

View all
EntryEntry nameGene nameLength
A0A087WS89A0A087WS89_MOUSE2510002D24Rik71
A0A087WSJ3A0A087WSJ3_MOUSE2510002D24Rik49

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
AK153794
EMBL· GenBank· DDBJ
BAE32185.1
EMBL· GenBank· DDBJ
mRNA

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp