Q3MKQ2 · BEX1_RAT
- ProteinProtein BEX1
- GeneBex1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids128 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Signaling adapter molecule involved in p75NTR/NGFR signaling (PubMed:16498402).
Plays a role in cell cycle progression and neuronal differentiation (PubMed:16498402).
Inhibits neuronal differentiation in response to nerve growth factor (NGF) (PubMed:16498402).
May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states (PubMed:16498402).
In absence of reductive stress, acts as a pseudosubstrate for the CRL2(FEM1B) complex: associates with FEM1B via zinc, thereby preventing association between FEM1B and its substrates (By similarity).
Plays a role in cell cycle progression and neuronal differentiation (PubMed:16498402).
Inhibits neuronal differentiation in response to nerve growth factor (NGF) (PubMed:16498402).
May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states (PubMed:16498402).
In absence of reductive stress, acts as a pseudosubstrate for the CRL2(FEM1B) complex: associates with FEM1B via zinc, thereby preventing association between FEM1B and its substrates (By similarity).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | metal ion binding | |
Molecular Function | molecular function inhibitor activity | |
Molecular Function | signaling receptor binding | |
Biological Process | axon development | |
Biological Process | axon regeneration | |
Biological Process | negative regulation of neuron differentiation | |
Biological Process | negative regulation of protein ubiquitination | |
Biological Process | positive regulation of neuroblast proliferation | |
Biological Process | regulation of apoptotic process | |
Biological Process | regulation of cell cycle | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameProtein BEX1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ3MKQ2
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 19 | Does not affect subcellular location. | ||||
Sequence: K → E | ||||||
Mutagenesis | 45 | Does not affect subcellular location. | ||||
Sequence: K → E | ||||||
Mutagenesis | 53-55 | Abolishes nuclear localization. | ||||
Sequence: RRR → AAA | ||||||
Mutagenesis | 105 | Abolishes phosphorylation, leading to degradation by the proteasome. | ||||
Sequence: S → A |
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000229775 | 1-128 | Protein BEX1 | |||
Sequence: MESKDQGAKNLNMENDHQKKEEKEEKPQDTIKREPVVAPTFEAGKNCAPRGGRRRFRVRQPIAHYRWDLMHRVGEPQGRMREENVQRFGEDMRQLMEKLRERQLSHSLRAVSTDPPHHDHHDEFCLMP | ||||||
Modified residue | 105 | Phosphoserine; by PKB/AKT1 | ||||
Sequence: S |
Post-translational modification
Phosphorylated. Phosphorylation of Ser-105 protects it from the proteasome.
Ubiquitinated. Degraded by the proteasome.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the central nervous system. Expressed in Schwann cells from newborn sciatic nerve.
Developmental stage
Oscillates during the cell cycle, being lowest at G1 and highest at S phase (at protein level).
Interaction
Subunit
Interacts with neurotrophin receptor p75NTR/NGFR (PubMed:16498402).
Interacts with OMP (By similarity).
Interacts with OMP (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q3MKQ2 | Ngfr P07174 | 4 | EBI-8089575, EBI-1038810 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-32 | Basic and acidic residues | ||||
Sequence: MESKDQGAKNLNMENDHQKKEEKEEKPQDTIK | ||||||
Region | 1-55 | Disordered | ||||
Sequence: MESKDQGAKNLNMENDHQKKEEKEEKPQDTIKREPVVAPTFEAGKNCAPRGGRRR | ||||||
Region | 107-128 | Disordered | ||||
Sequence: SLRAVSTDPPHHDHHDEFCLMP | ||||||
Region | 117-121 | His cluster | ||||
Sequence: HHDHH |
Domain
The histidine cluster (His cluster) and Cys-125 mediate zinc-binding.
Sequence similarities
Belongs to the BEX family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length128
- Mass (Da)15,248
- Last updated2006-04-04 v2
- Checksum13F8CCF5021C9D49
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A096MIT8 | A0A096MIT8_RAT | Bex1 | 128 |
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-32 | Basic and acidic residues | ||||
Sequence: MESKDQGAKNLNMENDHQKKEEKEEKPQDTIK | ||||||
Sequence conflict | 63 | in Ref. 2; AAX40672 | ||||
Sequence: A → S | ||||||
Sequence conflict | 76 | in Ref. 2; AAX40672 | ||||
Sequence: P → A | ||||||
Sequence conflict | 82 | in Ref. 2; AAX40672 | ||||
Sequence: E → D | ||||||
Sequence conflict | 94 | in Ref. 2; AAX40672 | ||||
Sequence: Q → H | ||||||
Sequence conflict | 97 | in Ref. 2; AAX40672 | ||||
Sequence: E → G | ||||||
Sequence conflict | 121 | in Ref. 2; AAX40672 | ||||
Sequence: H → N |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY208292 EMBL· GenBank· DDBJ | AAP81280.1 EMBL· GenBank· DDBJ | mRNA | ||
AY833554 EMBL· GenBank· DDBJ | AAX40672.1 EMBL· GenBank· DDBJ | mRNA |