Q3LAC4 · PREX2_MOUSE
- ProteinPhosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein
- GenePrex2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1598 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDP for free GTP. Its activity is synergistically activated by phosphatidylinositol 3,4,5-trisphosphate and the beta gamma subunits of heterotrimeric G protein. Mediates the activation of RAC1 in a PI3K-dependent manner. May be an important mediator of Rac signaling, acting directly downstream of both G protein-coupled receptors and phosphoinositide 3-kinase (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | GTPase activator activity | |
Molecular Function | guanyl-nucleotide exchange factor activity | |
Biological Process | adult locomotory behavior | |
Biological Process | dendrite morphogenesis | |
Biological Process | G protein-coupled receptor signaling pathway | |
Biological Process | phosphatidylinositol 3-kinase/protein kinase B signal transduction | |
Biological Process | regulation of signaling |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePhosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein
- Short namesP-Rex2; PtdIns(3,4,5)-dependent Rac exchanger 2
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ3LAC4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000286796 | 1-1598 | Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein | |||
Sequence: MSDESAREVDKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAAAKVDKNVTEETVKMLFSNIEEILIVHKEFLKVVEECLYPEPSAQQEVGACFLHFKDKFRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLLKELLKRTPRRHSDYTAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQAHIEGWEGSNITDTCTEMLMCGVLMKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGYRYVFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKSPEEKHEWFEAILKERERRKGLKLGMEQDTWVMISEQGEKLYKMMCKQGNLIKDRKRKLTTFPKCFLGSEFVSWLLEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRSEMQDVISKGVRLYCRLHSLFTPVVRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFAVGLCDNGFMHHVLEKSEFKDEPLLFRFFADEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFLRPFPEVDCFLKSCLNSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCIIKVNGINVSKETHASVIAHVTACRKYKRPMKQDSIQWVYDSLESAQEDIQKSHSKPPGDGAGDAFECKVEDVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGTKCNVVEKMVEPKGFFSLTAKILEALAKSDEHFVQNCTSLNSLNEVIATDLQSKFTSMCSERIEHVCHRISSYGRFSRVLKNRAWPTFKQAKPKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGVQLDSRKHNSHDKENKSVEPGKLSPMVYIQHTITTMAAPSGLSLGHKDGHGLQYLLKEEDLETQDIYHKLLGKLQTALKEVEMSVCQIDDLLSSITYSPKLERKTTECVTPMDSDNEKGERNSKRVCFNVAGDEQEDSGHDTVSNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDSGDELPISVRISHDKQDKIHTCLEQLFSQIDSIINLLKGQAVIRAFEQTKYLTPGRGLQEFQQEMEAKLSCPRRLRLHLKQDPWNLPSSIQALAQSIRKHAEEVKCRILLALLEYSDSETQLRRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKENEMETCEASRRWLDQIANAGVLFHFQSLLSPNLKDEQAMLEDTLVALFDLEKVSFFFKPSEEDPLVANVPLTYQVEGSRQALKVYFYMDSYHFEQLPQRLKNGGGFKIHPVLFSQALESMEGYCYRDNISVEEFQAQINTASLEKVKQYNQKLRAFYLDKSNSPPNTTSKAAYIDKLMKPLNALDELYRLITSFIRSKRIAACVNTPCSASGVGLLSVSSELCDRLGACHIIMCSSGVHRCTLSVTLEQTITLARSHGLPPRYIMQAMDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPVGEE |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 15-206 | DH | ||||
Sequence: LRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAAAKVDKNVTEETVKMLFSNIEEILIVHKEFLKVVEECLYPEPSAQQEVGACFLHFKDKFRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLLKELLKRTPRRHSDYTAVMEALQAMKAVCSNINEA | ||||||
Domain | 237-353 | PH | ||||
Sequence: EMLMCGVLMKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGYRYVFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKSPEEKHEWFEAILKERE | ||||||
Domain | 382-456 | DEP 1 | ||||
Sequence: CKQGNLIKDRKRKLTTFPKCFLGSEFVSWLLEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRY | ||||||
Domain | 483-558 | DEP 2 | ||||
Sequence: SLFTPVVRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFAVGLCDNGFMHHVLEKSEFKDEPLLFRFFAD | ||||||
Domain | 584-663 | PDZ 1 | ||||
Sequence: KSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFLRPFPEVDCFLKSCLNSRKPLRVLVS | ||||||
Domain | 669-746 | PDZ 2 | ||||
Sequence: TVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCIIKVNGINVSKETHASVIAHVTACRKYKRPMKQDSI | ||||||
Region | 1573-1598 | Disordered | ||||
Sequence: GVRDRTPQSAPRLYKLCEPPPPVGEE |
Domain
PH domain confers substrate specificity and recognition. Able to discriminate between RAC1, RHOA, and CDC42 (By similarity).
DH domain alone was unable to confer substrate specificity and recognition.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q3LAC4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length1,598
- Mass (Da)181,717
- Last updated2011-07-27 v2
- ChecksumAC9507BC9CC5EAD6
Q3LAC4-2
- Name2
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A087WRD8 | A0A087WRD8_MOUSE | Prex2 | 40 | ||
A0A087WS21 | A0A087WS21_MOUSE | Prex2 | 24 | ||
A0A087WRG8 | A0A087WRG8_MOUSE | Prex2 | 15 | ||
A0A087WRV5 | A0A087WRV5_MOUSE | Prex2 | 50 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_025164 | 698-734 | in isoform 2 | |||
Sequence: TVAAAAGLHPGQCIIKVNGINVSKETHASVIAHVTAC → ETFFAAASRSAPAGPLALPCPTEGSPQSARNGPLSLK | ||||||
Alternative sequence | VSP_025165 | 735-1598 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 1166 | in Ref. 1; CAJ33348 | ||||
Sequence: N → T | ||||||
Sequence conflict | 1176-1178 | in Ref. 1; CAJ33348 | ||||
Sequence: AFE → PFD |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AM109952 EMBL· GenBank· DDBJ | CAJ33348.1 EMBL· GenBank· DDBJ | mRNA | ||
AC102481 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC102529 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC102631 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC164600 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AK018093 EMBL· GenBank· DDBJ | BAB31066.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AK138884 EMBL· GenBank· DDBJ | BAE23811.1 EMBL· GenBank· DDBJ | mRNA | ||
AK142414 EMBL· GenBank· DDBJ | BAE25059.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |