Q3ICC5 · XNI_PSET1
- ProteinFlap endonuclease Xni
- Genexni
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids257 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Has flap endonuclease activity. During DNA replication, flap endonucleases cleave the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment.
Cofactor
Protein has several cofactor binding sites:
Note: Binds 2 Mg2+ per subunit. Only one magnesium ion has a direct interaction with the protein, the other interactions are indirect.
Note: Binds 1 K+ per subunit. The potassium ion strongly increases the affinity for DNA.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 112 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 179 | K+ (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 180 | K+ (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 188 | K+ (UniProtKB | ChEBI) | ||||
Sequence: P | ||||||
Binding site | 190 | K+ (UniProtKB | ChEBI) | ||||
Sequence: V | ||||||
Binding site | 193 | K+ (UniProtKB | ChEBI) | ||||
Sequence: I |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | 5'-3' exonuclease activity | |
Molecular Function | 5'-flap endonuclease activity | |
Molecular Function | DNA binding | |
Molecular Function | magnesium ion binding | |
Molecular Function | potassium ion binding | |
Biological Process | DNA replication, Okazaki fragment processing |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFlap endonuclease Xni
- EC number
- Short namesFEN
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Alteromonadales > Pseudoalteromonadaceae > Pseudoalteromonas
Accessions
- Primary accessionQ3ICC5
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000297867 | 1-257 | Flap endonuclease Xni | |||
Sequence: MKPHLLLIDALNLIRRIYAVDANQKHHSDEQMLKASCARVAHACSKLLSSTKATHAIAVFDGDKSWRYHFYKDYKHSRAPMPQILKDALVQFKAAIEETGIVVFEPINDEADDIIATLANKASHNNISSVIVSTDKGFLPFLNEHIAVYDYFKKHYLDQDSIKQRFGVEQKKLVEFWAFAGDKTNDIPGVKGIGTKSAQLLVNNYSSVEDALNDDALSASLRKKLTENMDMYVISKQLVSLRTDINLGFSLKQLRLN |
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 169-256 | 5'-3' exonuclease | ||||
Sequence: EQKKLVEFWAFAGDKTNDIPGVKGIGTKSAQLLVNNYSSVEDALNDDALSASLRKKLTENMDMYVISKQLVSLRTDINLGFSLKQLRL | ||||||
Region | 192-197 | Interaction with DNA | ||||
Sequence: GIGTKS |
Sequence similarities
Belongs to the Xni family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length257
- Mass (Da)28,983
- Last updated2005-11-08 v1
- ChecksumAD052C6D041DB6A9
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CR954247 EMBL· GenBank· DDBJ | CAI89505.1 EMBL· GenBank· DDBJ | Genomic DNA |