Q3E7K4 · QQS_ARATH
- ProteinProtein QQS
- GeneQQS
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Involved in regulating carbon and nitrogen allocation to starch and protein (PubMed:25146936).
Miscellaneous
The expression of QQS varies considerably among natural accessions as well as within populations directly sampled from the wild. This variation correlates negatively with the DNA methylation level of repeated sequences located within the 5'end of the gene.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Biological Process | innate immune response | |
Biological Process | negative regulation of starch metabolic process | |
Biological Process | positive regulation of protein metabolic process | |
Biological Process | starch biosynthetic process |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein QQS
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ3E7K4
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype, but increased leaf starch content and decreased protein content.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 27 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000431550 | 1-59 | Protein QQS | |||
Sequence: MKTNREQEIYVERSFKPNNSTIQNLMDIERFILPHTSTSGVARLKMRVISWVGLQFYNY |
Proteomic databases
Expression
Tissue specificity
Expressed in hypocotyls, leaves, vasculature, hydathodes, trichomes, pedicels, sepals, filaments, mature pollen, stigma papillae, styles, siliques, root and shoot tips, but not in shoot meristem, petals or root epidermis.
Induction
Down-regulated by cold (PubMed:25146936).
Up-regulated by treatment with 5-aza-2'-deoxycytidine (PubMed:23593031).
Up-regulated during the dark phase of the diurnal cycle (PubMed:19154206).
Regulated by the transcription factor WRKY46 and up-regulated by light (PubMed:24773321).
Up-regulated by treatment with 5-aza-2'-deoxycytidine (PubMed:23593031).
Up-regulated during the dark phase of the diurnal cycle (PubMed:19154206).
Regulated by the transcription factor WRKY46 and up-regulated by light (PubMed:24773321).
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length59
- Mass (Da)7,052
- Last updated2005-11-08 v1
- ChecksumD1CCA4B1E8BABC35
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1I9LPF7 | A0A1I9LPF7_ARATH | QQS | 58 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EU805808 EMBL· GenBank· DDBJ | ACE80938.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP000732 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CP002686 EMBL· GenBank· DDBJ | AEE77653.1 EMBL· GenBank· DDBJ | Genomic DNA |