Q39445 · TBB_CICAR
- ProteinTubulin beta chain
- GeneTUBB
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids449 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin.
Cofactor
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 11 | GTP (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 71 | GTP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 71 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 140 | GTP (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 144 | GTP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 145 | GTP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 146 | GTP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 206 | GTP (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 228 | GTP (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | microtubule | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | metal ion binding | |
Molecular Function | structural constituent of cytoskeleton | |
Biological Process | microtubule-based process |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameTubulin beta chain
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > Hologalegina > IRL clade > Cicereae > Cicer
Accessions
- Primary accessionQ39445
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000048336 | 1-449 | Tubulin beta chain | |||
Sequence: MREILHVQGGQCGNQIGSKFWEVICDEHGIDQTGKYISEGGSDTQLERINVYYNEASGGRYVPRAVLMDLEPGTMESIRSGPFGKIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYVSLTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQIINVQNKNSSYFVEWIPNNVKSSVCDIPPKNLKMSSTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDAIAEEEDEYEEEGEEQYDEQ |
Proteomic databases
Interaction
Subunit
Dimer of alpha and beta chains. A typical microtubule is a hollow water-filled tube with an outer diameter of 25 nm and an inner diameter of 15 nM. Alpha-beta heterodimers associate head-to-tail to form protofilaments running lengthwise along the microtubule wall with the beta-tubulin subunit facing the microtubule plus end conferring a structural polarity. Microtubules usually have 13 protofilaments but different protofilament numbers can be found in some organisms and specialized cells.
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length449
- Mass (Da)50,577
- Last updated1996-11-01 v1
- ChecksumFC3E349166105CBA
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1S2X7K7 | A0A1S2X7K7_CICAR | TUBB | 449 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X98406 EMBL· GenBank· DDBJ | CAA67056.1 EMBL· GenBank· DDBJ | mRNA |