Q38919 · RAC4_ARATH
- ProteinRac-like GTP-binding protein ARAC4
- GeneARAC4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids195 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation (By similarity).
Involved in cell polarity control during the actin-dependent tip growth of root hairs, thus regulating root hair length and root hair initiation (PubMed:30770391).
Contributes, in a SPK1-dependent manner, to the prevention of cortical microtubules organization into parallel arrays oriented perpendicular to the axis of cell elongation to limit anisotropic cell growth during petal development (PubMed:31623377).
May regulate a WAVE complex that activates the Arp2/3 complex
Involved in cell polarity control during the actin-dependent tip growth of root hairs, thus regulating root hair length and root hair initiation (PubMed:30770391).
Contributes, in a SPK1-dependent manner, to the prevention of cortical microtubules organization into parallel arrays oriented perpendicular to the axis of cell elongation to limit anisotropic cell growth during petal development (PubMed:31623377).
May regulate a WAVE complex that activates the Arp2/3 complex
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleolus | |
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | anisotropic cell growth | |
Biological Process | cell morphogenesis | |
Biological Process | cortical microtubule organization | |
Biological Process | microtubule cytoskeleton organization | |
Biological Process | petal morphogenesis | |
Biological Process | pollen tube growth | |
Biological Process | regulation of stomatal movement | |
Biological Process | response to light stimulus | |
Biological Process | root hair elongation | |
Biological Process | root hair initiation | |
Biological Process | small GTPase-mediated signal transduction |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameRac-like GTP-binding protein ARAC4
- Short namesAtRAC4
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ38919
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Fewer and shorter root hairs (PubMed:30770391).
Plants lacking both ARAC4/ROP2 and ARAC3/ROP6 exhibit long and narrow petals, as well as increased anisotropic cell expansion of petal epidermis during flower development, as a result of increased microtubule ordering in petal abaxial epidermal cells (PubMed:31623377).
Plants lacking both ARAC4/ROP2 and ARAC3/ROP6 exhibit long and narrow petals, as well as increased anisotropic cell expansion of petal epidermis during flower development, as a result of increased microtubule ordering in petal abaxial epidermal cells (PubMed:31623377).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000198918 | 1-192 | Rac-like GTP-binding protein ARAC4 | |||
Sequence: MASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNKNRC | ||||||
Modified residue | 192 | Cysteine methyl ester | ||||
Sequence: C | ||||||
Lipidation | 192 | S-geranylgeranyl cysteine | ||||
Sequence: C | ||||||
Propeptide | PRO_0000227583 | 193-195 | Removed in mature form | |||
Sequence: AFL |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Ubiquitous.
Developmental stage
In root trichoblasts, accumulates into patches at the basal end of the cell before a hair bulge is visible and remain concentrated at the tip of the bulge and in the growing hair.
Gene expression databases
Interaction
Subunit
Interacts with SPK1, ICR1, ICR5 and PIR.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q38919 | FER Q9SCZ4 | 2 | EBI-1548187, EBI-15880405 | |
BINARY | Q38919 | SPK1 Q8SAB7 | 3 | EBI-1548187, EBI-1547917 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 34-42 | Effector region | ||||
Sequence: YVPTVFDNF |
Sequence similarities
Belongs to the small GTPase superfamily. Rho family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length195
- Mass (Da)21,636
- Last updated1997-11-01 v1
- Checksum90899399AB7EA658
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U45236 EMBL· GenBank· DDBJ | AAC49854.1 EMBL· GenBank· DDBJ | mRNA | ||
U49972 EMBL· GenBank· DDBJ | AAC78391.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF115471 EMBL· GenBank· DDBJ | AAF40243.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC022472 EMBL· GenBank· DDBJ | AAF79903.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE29934.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF332438 EMBL· GenBank· DDBJ | AAG48801.1 EMBL· GenBank· DDBJ | mRNA | ||
AF360154 EMBL· GenBank· DDBJ | AAK25864.1 EMBL· GenBank· DDBJ | mRNA | ||
AY056308 EMBL· GenBank· DDBJ | AAL07157.1 EMBL· GenBank· DDBJ | mRNA |