Q38851 · MYB6_ARATH
- ProteinTranscription repressor MYB6
- GeneMYB6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids236 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 37-61 | H-T-H motif | ||||
Sequence: WRSLPKSAGLLRCGKSCRLRWINYL | ||||||
DNA binding | 89-112 | H-T-H motif | ||||
Sequence: WSLIAGRLPGRTDNEIKNYWNTHI |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | transcription cis-regulatory region binding |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTranscription repressor MYB6
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ38851
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000358832 | 1-236 | Transcription repressor MYB6 | |||
Sequence: MGRSPCCEKAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINYLRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHGIDPQTHRQINESKTVSSQVVVPIQNDAVEYSFSNLAVKPKTENSSDNGASTSGTTTDEDLRQNGECYYSDNSGHIKLNLDLTLGFGSWSGRIVGVGSSADSKPWCDPVMEARLSLL |
Proteomic databases
Expression
Tissue specificity
Expressed in roots, stems, flower buds, and siliques.
Induction
By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 9-61 | HTH myb-type 1 | ||||
Sequence: KAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINYL | ||||||
Domain | 62-116 | HTH myb-type 2 | ||||
Sequence: RPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKL | ||||||
Region | 159-181 | Disordered | ||||
Sequence: PKTENSSDNGASTSGTTTDEDLR |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length236
- Mass (Da)26,474
- Last updated1996-11-01 v1
- ChecksumD53F9AC798D7BBCB
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U26936 EMBL· GenBank· DDBJ | AAA98761.1 EMBL· GenBank· DDBJ | mRNA | ||
AY519604 EMBL· GenBank· DDBJ | AAS10074.1 EMBL· GenBank· DDBJ | mRNA | ||
AL161515 EMBL· GenBank· DDBJ | CAB78069.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002687 EMBL· GenBank· DDBJ | AEE82750.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT004171 EMBL· GenBank· DDBJ | AAO42191.1 EMBL· GenBank· DDBJ | mRNA | ||
BT005085 EMBL· GenBank· DDBJ | AAO50618.1 EMBL· GenBank· DDBJ | mRNA | ||
AY086813 EMBL· GenBank· DDBJ | AAM63862.1 EMBL· GenBank· DDBJ | mRNA | ||
Z95782 EMBL· GenBank· DDBJ | CAB09214.1 EMBL· GenBank· DDBJ | mRNA |