Q33DK1 · WOX3_ORYSJ
- ProteinWUSCHEL-related homeobox 3
- GeneWOX3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids203 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Transcription factor which may be involved in developmental processes. Seems to act as repressor of YAB5.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 4-68 | Homeobox; WUS-type | ||||
Sequence: TPSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQRL |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Biological Process | plant organ development |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameWUSCHEL-related homeobox 3
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ33DK1
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000308637 | 1-203 | WUSCHEL-related homeobox 3 | |||
Sequence: MPQTPSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQRLRRRLCARHQQQPSPPSSTVPPAPTAAAAGAVVQVHPAVMQLHHHHHHHHPYAAAAAAQSHHLQQQQQQQAEWPAAVDYCSTASASASATAADMAIPPCCRPLKTLELFPTKSTSGGLKEDCCSSSKSSSCSTSTN |
Proteomic databases
Expression
Tissue specificity
Expressed in leaf primordia, young leaves, floret meristems, floral organ primordia (except carpel primordium), stamens and carpels. Does not show polar expression pattern.
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q33DK1 | WOX1 Q7XM13 | 3 | EBI-1100563, EBI-1100547 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 73-95 | Disordered | ||||
Sequence: CARHQQQPSPPSSTVPPAPTAAA | ||||||
Region | 109-135 | Disordered | ||||
Sequence: LHHHHHHHHPYAAAAAAQSHHLQQQQQ | ||||||
Region | 180-203 | Disordered | ||||
Sequence: STSGGLKEDCCSSSKSSSCSTSTN |
Sequence similarities
Belongs to the WUS homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length203
- Mass (Da)22,352
- Last updated2005-12-06 v1
- ChecksumFB36267C29FEF655
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0P0Y5V3 | A0A0P0Y5V3_ORYSJ | Os11g0102100 | 234 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB218893 EMBL· GenBank· DDBJ | BAE48302.1 EMBL· GenBank· DDBJ | mRNA | ||
DP000010 EMBL· GenBank· DDBJ | ABA91096.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DP000011 EMBL· GenBank· DDBJ | ABA95570.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008217 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AP008218 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AP014967 EMBL· GenBank· DDBJ | BAT12270.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014968 EMBL· GenBank· DDBJ | BAT15447.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000148 EMBL· GenBank· DDBJ | EAZ17132.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AM234748 EMBL· GenBank· DDBJ | CAJ84140.1 EMBL· GenBank· DDBJ | mRNA |