Q338Z4 · Q338Z4_ORYSJ
- ProteinNAD(P)H-hydrate epimerase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids548 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX.
Catalytic activity
- (6R)-NADHX = (6S)-NADHX
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 potassium ion per subunit.
Pathway
Cofactor metabolism; pyridoxal 5'-phosphate salvage; pyridoxal 5'-phosphate from pyridoxamine 5'-phosphate: step 1/1.
Cofactor metabolism; pyridoxal 5'-phosphate salvage; pyridoxal 5'-phosphate from pyridoxine 5'-phosphate: step 1/1.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 150-154 | (6S)-NADPHX (UniProtKB | ChEBI) | ||||
Sequence: NNGGD | ||||||
Binding site | 151 | K+ (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 215 | K+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 219-225 | (6S)-NADPHX (UniProtKB | ChEBI) | ||||
Sequence: GFSFHGT | ||||||
Binding site | 256 | (6S)-NADPHX (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 259 | K+ (UniProtKB | ChEBI) | ||||
Sequence: S |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | cytosol | |
Cellular Component | mitochondrion | |
Molecular Function | FMN binding | |
Molecular Function | metal ion binding | |
Molecular Function | NADHX epimerase activity | |
Molecular Function | NADPHX epimerase activity | |
Molecular Function | pyridoxamine phosphate oxidase activity | |
Biological Process | NADH metabolic process | |
Biological Process | NADP metabolic process | |
Biological Process | pyridoxine biosynthetic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNAD(P)H-hydrate epimerase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ338Z4
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 462 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 547 | PTMeXchange | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 31-58 | Disordered | ||||
Sequence: SPTPPPPPHSSSLPRSPSPRPRLPLPPP | ||||||
Domain | 100-315 | YjeF N-terminal | ||||
Sequence: AAEIDEQLMGPLGFSVDQLMELAGLSVAAAVAEVYKLGEHTRVLVICGPGNNGGDGLVAARHLHHFGYKPSVCYPKRTPKPLYSGLCTQLESLTIPFVPVEDLPANLSEEFDIIIDAMFGFSFHGTPRPPFDDLINRLVSLSAIDNSAKRPAIVSVDIPSGWHVEEGDINGGGFKPDMLVSLTAPKLCAKKFTGPHHFLGGRFVPPPIVSKYKLHL |
Sequence similarities
Belongs to the NnrE/AIBP family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length548
- Mass (Da)60,478
- Last updated2005-12-06 v1
- Checksum30147AB2871CBEB9
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0P0XTG9 | A0A0P0XTG9_ORYSJ | Os10g0377800 | 523 | ||
A0A0P0XTK4 | A0A0P0XTK4_ORYSJ | Os10g0377800 | 325 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DP000086 EMBL· GenBank· DDBJ | ABB47388.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014966 EMBL· GenBank· DDBJ | BAT10606.1 EMBL· GenBank· DDBJ | Genomic DNA |