Q33884 · CCMF2_ARATH
- ProteinCytochrome c biogenesis CcmF N-terminal-like mitochondrial protein 2
- GeneCCMFN2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids203 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Forms a complex with CCMFC, CCMFN1 and CCMH that performs the assembly of heme with c-type apocytochromes in mitochondria.
Miscellaneous
A stretch of 270 kb of the mitochondrial genome is duplicated within the centromere of chromosome 2 resulting in the duplication of the gene. The expression of this duplicated gene (At2g07768) is not demonstrated. It is also probably not RNA edited and therefore differs in all the positions known to be edited.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Molecular Function | heme binding | |
Molecular Function | heme transmembrane transporter activity | |
Biological Process | cytochrome complex assembly |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCytochrome c biogenesis CcmF N-terminal-like mitochondrial protein 2
- Alternative names
Gene names
Encoded on
- Mitochondrion
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ33884
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 44-64 | Helical | ||||
Sequence: IWILTCWWFLTVGILLGSWWA | ||||||
Transmembrane | 143-163 | Helical | ||||
Sequence: IFLWWFFLLMTGISMILFYQM |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000201595 | 1-203 | Cytochrome c biogenesis CcmF N-terminal-like mitochondrial protein 2 | |||
Sequence: VDTGREQAKRVVRNGKKETTTLPLCWTAGANTVVSDQDQEPIRIWILTCWWFLTVGILLGSWWAYHELGWGGWWFWDPVENASFMPWVLATACIHSVILPLLHSWTLFLNIVTFLCCVLGTFSIRSGLLASVHSFATDDTRGIFLWWFFLLMTGISMILFYQMKQQASVRRTYKKEMVVARSTLVHLRHSARAQPRPVMLWKN |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with CCMFC, CCMFN1, CCMH and CYTC-1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q33884 | CCMFC P93286 | 4 | EBI-763400, EBI-1797481 | |
BINARY | Q33884 | CCMFN1 Q9T6H8 | 5 | EBI-763400, EBI-1797466 | |
BINARY | Q33884 | CCMH Q9XI46 | 3 | EBI-763400, EBI-763363 | |
BINARY | Q33884 | CYC1-2 Q9FKS5 | 4 | EBI-763400, EBI-1777995 |
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the CcmF/CycK/Ccl1/NrfE/CcsA family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length203
- Mass (Da)23,535
- Last updated2023-09-13 v3
- Checksum251A3AD2D7D04590
Sequence caution
Features
Showing features for non-terminal residue, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: V | ||||||
Sequence conflict | 21 | in Ref. 4; AC007730 | ||||
Sequence: T → S |
RNA Editing
Edited at positions 22 59 70 76 87 93 101 107 115 119 131 156
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X98302 EMBL· GenBank· DDBJ | CAA66946.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
Y08501 EMBL· GenBank· DDBJ | CAA69836.3 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
BK010421 EMBL· GenBank· DDBJ | DAB41519.2 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AC007143 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC007730 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
EF488894 EMBL· GenBank· DDBJ | ABS50606.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
EF488895 EMBL· GenBank· DDBJ | ABS50607.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |