Q2Y2M6 · NCAP_AMPV1
- ProteinNucleoprotein
- GeneN
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids394 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Encapsidates the viral RNA genome by forming a left-handed helical nucleocapsid that protects the RNA from nucleases. RNA replication depends on the availability of soluble nucleoprotein. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | helical viral capsid | |
Cellular Component | host cell cytoplasm | |
Cellular Component | ribonucleoprotein complex | |
Cellular Component | viral nucleocapsid | |
Molecular Function | RNA binding |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameNucleoprotein
- Short namesProtein N
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Negarnaviricota > Haploviricotina > Monjiviricetes > Mononegavirales > Pneumoviridae > Metapneumovirus > Metapneumovirus avis
- Virus hosts
Accessions
- Primary accessionQ2Y2M6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes in cytoplasmic inclusion bodies.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000390371 | 1-394 | Nucleoprotein | |||
Sequence: MSLQGIQLSDLSYKHAILKESQYTIKRDVGTTPAVTPSSLQREVSLLCGEILYAKHTDYSHAAEVGMQYVSTTLGAERTQQILKNSGSEVQAVLTKTYSLGKGKNSKGEELQMLDIHGVEKSWVEEVDKEARKTMASATKDNSGPIPQNQRPSSPDAPIILLCIGALIFTKPASTIEVGLETAVRRANRVLNDALKRFPRIDIPKIARSFYDLFEQKVYYRSLFIEYGKALGSSSTGSKAESLFVNIFMQAYGAGQTMLRWGAIARSSNNIMLGHVSVQAELKQVTEVYDLVREMGPESGLLHLRQSPKAGLLSLANCPNFASVVLGNASGLGILGMYRGRVPNTELFAAAESYARSLKESNKINFSSLGLTEEEKEAAENFLNINEEGQNDYE |
Interaction
Subunit
Homomultimerizes to form the nucleocapsid. Binds to viral genomic RNA. Interacts with the phosphoprotein P. When in a monomeric RNA-free form, interacts with the phosphoprotein (via N-terminus). Interacts with protein M2-1; this interaction allows the association of nucleocapsid with the matrix protein.
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 131-153 | Disordered | ||||
Sequence: ARKTMASATKDNSGPIPQNQRPS | ||||||
Compositional bias | 137-153 | Polar residues | ||||
Sequence: SATKDNSGPIPQNQRPS |
Sequence similarities
Belongs to the paramyxoviruses nucleocapsid family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length394
- Mass (Da)43,229
- Last updated2005-12-20 v1
- Checksum37E47DD85630861B
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 137-153 | Polar residues | ||||
Sequence: SATKDNSGPIPQNQRPS |
Keywords
- Technical term